KEGG   Gallus gallus (chicken): 414854Help
Entry
414854            CDS       T01006                                 

Gene name
CYP19A1
Definition
(RefSeq) aromatase
  KO
K07434  aromatase [EC:1.14.14.14]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00140  Steroid hormone biosynthesis
gga01100  Metabolic pathways
Module
gga_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    414854 (CYP19A1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     414854 (CYP19A1)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP19 family
   414854 (CYP19A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 414854
NCBI-ProteinID: NP_001001761
CGNC: 10026
Ensembl: ENSGALG00000013294
Position
10
AA seq 502 aa AA seqDB search
MIPETLNPLNYFTSLVPDLMPVATVPIIILICFLFLIWNHEETSSIPGPGYCMGIGPLIS
HGRFLWMGVGNACNYYNKTYGEFVRVWISGEETFIISKSSSVFHVMKHWNYVSRFGSKLG
LQCIGMYENGIIFNNNPAHWKEIRPFFTKALSGPGLVRMIAICVESTIVHLDKLEEVTTE
VGNVNVLNLMRRIMLDTSNKLFLGVPLDESAIVLKIQNYFDAWQALLLKPDIFFKISWLC
KKYEEAAKDLKGAMEILIEQKRQKLSTVEKLDEHMDFASQLIFAQNRGDLTAENVNQCVL
EMMIAAPDTLSVTLFIMLILIAEHPTVEEKMMREIETVMGDRDVQSDDMPNLKIVENFIY
ESMRYQPVVDLIMRKALQDDVIDGYPVKKGTNIILNIGRMHKLEFFPKPNEFSLENFEKN
VPSRYFQPFGFGPRGCVGKFIAMVMMKAILVTLLRRCRVQTMKGRGLNNIQKNNDLSMHP
IERQPLLEMVFTPRSPNKNQSD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgataccagaaactttgaatccactgaactacttcaccagcctggtaccagacttgatg
ccagttgccacagtgcctatcatcattctcatctgctttctgtttctaatatggaatcat
gaagaaacatcatcaataccagggccaggatactgcatgggaattgggcctctcatttca
catgggagatttctctggatgggagtaggtaatgcctgcaactactacaacaagacatat
ggagaatttgtgagagtttggatcagcggtgaagaaacatttataattagcaaatcctcc
agcgtatttcacgtaatgaaacactggaactatgtttctcgatttgggagcaagcttgga
ttacagtgcattggcatgtatgaaaatgggattatatttaataacaacccagcacactgg
aaggagatccgacccttcttcaccaaagccctgtctggtcctggtcttgtgcgcatgata
gccatttgtgttgaatcaacaattgttcacctggacaaactagaagaagtgaccactgaa
gtaggaaacgtcaatgtgttgaacctcatgagacggattatgcttgacacgtctaacaag
ctctttctaggggtccctttggatgaaagtgccattgtacttaagattcagaactacttt
gatgcttggcaagctcttctattaaagcccgacatattttttaagatttcttggctttgc
aagaagtatgaagaggcagccaaagacttgaaaggagcaatggaaatcttaatagaacag
aaacgacaaaagctttccactgttgaaaagttggatgagcacatggattttgcatctcag
ctgatttttgcacagaacagaggagatctgactgctgagaatgtgaaccagtgtgtgctg
gagatgatgattgctgctcctgatactctgtccgtgacactcttcattatgctaatactg
attgcagagcaccccacagtggaggagaagatgatgagagaaattgaaactgttatgggt
gacagagatgtacagagtgatgacatgccaaacctcaaaattgtggagaattttatttat
gagagcatgagataccagccagttgtggacttaatcatgagaaaagctttacaagatgat
gtaattgatggatatcctgtgaaaaagggaacaaacattattctcaacattggacgcatg
cacaagcttgaattcttcccaaaaccgaatgagttttctcttgaaaactttgagaagaat
gttccatcacgctatttccagccatttggatttggccctcggggctgtgtaggaaagttt
attgccatggtaatgatgaaagcaattctggtgactcttctgagacggtgcagagtacag
acaatgaaaggaagaggacttaacaacatccagaaaaacaatgacttatccatgcaccca
atagaaaggcagcctctgctggagatggtttttacaccaagaagcccaaacaagaatcag
agtgactaa

DBGET integrated database retrieval system