KEGG   Gallus gallus (chicken): 414879
Entry
414879            CDS       T01006                                 

Gene name
UBA5
Definition
(RefSeq) ubiquitin-like modifier-activating enzyme 5
  KO
K12164  ubiquitin-like modifier-activating enzyme 5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    414879 (UBA5)
Ubiquitin system [BR:gga04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   414879 (UBA5)
SSDB
Motif
Pfam: ThiF UDPG_MGDP_dh_N 2-Hacid_dh_C NAD_binding_7 ApbA FAD_binding_3 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 414879
NCBI-ProteinID: NP_001001765
CGNC: 8897
Ensembl: ENSGALG00000032382
UniProt: Q6IVA4
Position
2
AA seq 397 aa
MAERVELLERRVRELERELELARGGRASARARIETMSPEVTDSNPYSRLMALKRMGIVKD
YEKIRTFTVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSK
VQAAEHTLRNINPDVQFEVHNYNITTLDNFEHFMDRISNGALEEGKPVDLVLSCVDNFEA
RMAINTACNELGQIWMESGVSENAVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKRE
GVCAASLPTTMGVVAGILVQNVLKYLLNFGTVSYYLGYNAMQDFFPTMAMKPNPQCSDQN
CRKQQENYKIKEAAQPKQEEIHQEEEIVHEDNDWGIELVSETTEDELKAASGPVPDLPVG
ITVAYTIPNKEENLTAEETVAESEESLEDLMAKMRNL
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggccgagcgggtggagctgctggagcgccgcgtgcgggagctggagcgggaactggag
ctggcccggggcgggcgggcgtcggcgcgggcccgcatcgagaccatgagcccggaggtg
acggactccaacccctacagtcgcttgatggcattaaaaaggatgggaattgtcaaagac
tacgagaaaatccgtactttcacagttgcaatagtaggcgtgggtggagtgggaagtgtg
actgctgagatgttgacaaggtgtggcatcggtaagcttcttctgtttgattatgacaaa
gtggaactggcaaacatgaacagactcttcttccaacctcatcaagctggattaagtaaa
gtgcaagcagcagagcataccttgagaaatattaatcctgatgtgcagtttgaagtacac
aactacaacatcacgacgctggacaattttgaacatttcatggatagaataagtaatggt
gcgctagaggaagggaagcctgttgatcttgttctaagctgtgtggacaactttgaagct
cgcatggcaattaacacggcctgcaatgagcttggacaaatctggatggagtccggagtg
agtgaaaatgcagtgtcgggacacatccagctgatcattcctggtgaatctgcttgtttt
gcgtgtgctcctccacttgtggttgctgcaaatattgatgagaagacattaaaacgagaa
ggagtttgtgcagctagtcttccaacaaccatgggggttgtggctggaattctcgtacag
aatgttctgaagtatcttttaaattttggtactgtgagttactatcttggctacaacgcg
atgcaggatttctttccaactatggctatgaagccaaatccacaatgtagtgatcaaaat
tgcaggaaacagcaagaaaattataagataaaagaagctgcacaaccaaaacaagaagaa
attcatcaggaagaagaaatagtgcatgaagacaatgactggggcatcgaattagtatca
gaaactacagaagatgagctgaaggctgcttctggtccggtacctgatcttcctgtcgga
attactgtagcatatactatcccaaacaaggaagagaatctgacagctgaagaaacagtg
gctgagtctgaagaaagcctggaagatctcatggccaaaatgcgcaacttgtag

DBGET integrated database retrieval system