KEGG   Gallus gallus (chicken): 414885
Entry
414885            CDS       T01006                                 

Gene name
CCKBR
Definition
(RefSeq) gastrin/cholecystokinin type B receptor
  KO
K04195  cholecystokinin B receptor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    414885 (CCKBR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    414885 (CCKBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    414885 (CCKBR)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    414885 (CCKBR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srw 7TM_GPCR_Srh 7TM_GPCR_Srx Git3
Other DBs
NCBI-GeneID: 414885
NCBI-ProteinID: NP_001001742
CGNC: 66234
Ensembl: ENSGALG00000039837
UniProt: Q7T1P8
Position
1
AA seq 436 aa
MDPRRLNESLQELLCRPGNGTGSANGTGTGPTWNGSACDLLRRGLRGPQAPKELDLTVRV
LLYALIFVLSVCGNALVVAVLLLNRRLRTVTNSFLLSLALSDLMLALCCMPFTLIPNLMG
TFVFGEAVCKLMAYLMGVSVSVSTFSLVAIAIERYSAICNPLQSRVWQTRSHACRVIAST
WLFSALLMLPYAVYSTTRLLPVPGARPPLSQCTHAWPSEHVRQAWYVLLLLVLFFIPGVV
MIVAYGLISRELYRGIRFELDIKGEAAAQRSTEPLPTCDEGDGCYLQLSRPGGALELRAL
GAAGAQQERARINSSEAKLVAKRRVIRMLVVIVAMFFLCWLPIFAANTWRAFAPRAAQRA
LSGTPISFIHLLSYTSACANPLIYCFMNRRFRSAFLGTCAGCRRACPRRAPDEDVANANA
SLSKFSYTTVSSLGPP
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggacccgaggcgactgaacgagtccctgcaggagctgctctgccgccccgggaacggt
accggctccgccaacggcaccgggaccggccccacctggaacggctccgcctgcgacctc
ctccgcaggggcctccgggggccgcaggctcccaaagagctggacctgacggtgcgcgtc
ctgctgtacgcgctgatcttcgtgctgagcgtctgcgggaacgccctggtggtggccgtg
ctgctcctgaaccgccgcctgcgcaccgtcaccaactctttcctgctgtccctggcgctc
agcgacctgatgctggcgctctgctgcatgcccttcaccctcatccccaacctcatgggc
accttcgtcttcggagaggccgtctgcaagttgatggcctacctgatgggcgtctccgtc
tcggtctccaccttcagcctggtggccatcgccatcgagcggtacagcgccatctgcaac
ccgctgcagtcccgcgtgtggcagacacgctcgcacgcctgccgggtgatcgccagcacc
tggctcttctcagcgctgctcatgttgccctacgctgtgtacagcaccacgcggctgctg
cccgtccccggcgcccgcccgcccctcagccagtgcactcacgcctggcccagcgagcac
gtgaggcaggcatggtatgtcctgctgctcctcgtcctcttcttcattccgggcgtggtg
atgatcgtggcttacgggctcatctcccgcgagctgtaccgcgggatccgctttgagctg
gacatcaagggggaagcagcagcccagcgcagcacagaaccgttgcccacctgcgacgag
ggggacggctgctacctgcagctctcacggccgggcggtgcgctggagctgcgggcgctg
ggcgcggcgggggcacaacaggagcgggcgcgcatcaacagctcagaggcaaagctggtg
gccaagcggcgcgtcatccgcatgctggtggtcatcgtggccatgttcttcctctgctgg
ctgcccatctttgcggccaacacgtggcgtgccttcgcaccgcgggcagcccagcgcgcg
ctctcggggacgcccatctccttcatccacctgctgtcctacacctccgcctgcgccaac
ccgctcatctactgcttcatgaaccgccgcttccgcagcgccttcctgggcacctgtgcc
ggctgccgccgtgcctgcccgcgccgcgcgcccgacgaggacgtggccaacgccaacgca
tcgctctccaagttcagctacaccactgtcagcagcctcggccccccctga

DBGET integrated database retrieval system