KEGG   Gallus gallus (chicken): 415316
Entry
415316            CDS       T01006                                 

Gene name
NPTN
Definition
(RefSeq) neuroplastin precursor
  KO
K22653  neuroplastin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    415316 (NPTN)
Cell adhesion molecules [BR:gga04515]
 Immunoglobulin superfamily
  Neuroplastin
   415316 (NPTN)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set C2-set
Other DBs
NCBI-GeneID: 415316
NCBI-ProteinID: NP_001280138
CGNC: 1224
Ensembl: ENSGALG00000001741
Position
10
AA seq 397 aa
MPRSGPLPAAFSLLLLTAALLPVPSAAQNAGFVKSTMSETKLTGDAFELYCDVVGNPTPE
IQWWYAEVNRAESFKQLWDGARKRRVTINTAYGANGVSVLRITRLTLEDSGTYECRASND
PRRNDLRQNPSITWIRAQATISVLQKPRINASEDVTIQVYGQAAITLQCNLTTSPSPLSA
SYWVKNGEEIPGTRKTSNTTEYKILKPRAEESGEYLCVFVFSNSPVANATIEVRAIPDIT
GHKRSENKNEGQEALMYCKSVGFPHPEWVWRKKVNGVFEDINNSSGRFFISNKDNYTELS
ITNLQINEDPGEYQCNATNQIGSTSVTTILRVRSHLAPLWPFLGILAEIFILVFIIVIYE
KRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgccgcgctccggcccgctccccgccgccttctccttgctgctgctgacggccgcgctg
ctgccggtgccctccgccgcgcagaacgctgggtttgtcaagtcgaccatgtcagaaact
aagctcacgggggacgcctttgaactgtactgtgatgtggttgggaatcccactccagag
atccagtggtggtatgctgaagtcaaccgggctgagtctttcaaacagctgtgggatggc
gctcggaagcgccgtgtcaccattaacaccgcctacggggcgaacggggtgagtgtgctg
agaataacccgccttaccctggaagactctgggacttacgagtgcagggccagcaacgat
cccaggaggaatgacttgaggcaaaatccctccataacgtggattcgagcccaggctact
ataagcgtccttcagaagccaaggatcaatgccagcgaggacgtaaccatccaagtttat
ggtcaggccgccatcacattacagtgtaacctcaccaccagtcccagccccctctctgcc
agctactgggtgaagaatggagaagagattcctggcactagaaaaacctcaaacactaca
gaatacaagattttgaagcccagagcagaagagtcaggggaatacttgtgcgtgtttgtg
ttttcaaactctcctgtagccaacgccactatagaagtgagagctatccctgacatcacc
ggccacaagcgaagcgagaataaaaacgaggggcaggaggcactcatgtactgcaagtct
gtgggcttcccacatcccgagtgggtgtggcgcaagaaggtcaatggagtgtttgaggac
atcaacaactcttctggaagattctttatttcaaataaagacaactacactgagctcagc
atcacaaacctacagatcaacgaggatcccggcgagtaccagtgcaacgccaccaaccag
atcggctccacgtccgtcacaaccatcctgcgtgtccgcagccacttggctcctctttgg
cccttcctggggatcctggcagaaatttttatcctcgttttcatcatagttatttatgag
aaaaggaagcggccagacgaagtcccagacgatgatgaaccagctgggccaatgaaaacc
aattctacaaacaatcataaagataaaaacttacgccagagaaacacaaattaa

DBGET integrated database retrieval system