KEGG   Gallus gallus (chicken): 415319
Entry
415319            CDS       T01006                                 

Gene name
ARIH1
Definition
(RefSeq) E3 ubiquitin-protein ligase ARIH1
  KO
K11968  ariadne-1 [EC:2.3.2.31]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    415319 (ARIH1)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     415319 (ARIH1)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    415319 (ARIH1)
SSDB
Motif
Pfam: IBR
Other DBs
NCBI-GeneID: 415319
NCBI-ProteinID: NP_001025558
CGNC: 1344
Ensembl: ENSGALG00000001901
UniProt: Q5F465
Position
10
AA seq 349 aa
MQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVE
CNRLLKWCPAPDCHHVVKVQYPDAKPVRCKCGRQFCFNCGENWHDPVKCKWLKKWIKKCD
DDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYN
CNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQH
NMSWIEVQFLKKAVDVLCQCRATLMYTYVFAFYLKKNNQSIIFENNQADLENATEVLSGY
LERDISQDSLQDIKQKVQDKYRYCESRRRVLLQHVHEGYEKDLWEYIED
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcagtgctggagtgaatatttaactaccaaaataatggaggaaggcatgggacagacc
atttcatgccctgctcatggctgtgatatcttagtcgatgacaatacagttatgcgtctg
atcacagattccaaggtgaaattaaagtaccagcatttaataaccaatagttttgtagag
tgtaatcgactgttaaaatggtgtcctgccccagactgccaccatgttgttaaagtccag
tatcctgatgctaaacctgttcgctgcaaatgtggacgtcagttttgctttaactgcggt
gaaaactggcacgaccctgttaaatgcaagtggttaaagaaatggattaagaagtgtgat
gatgacagtgaaacttctaattggattgcagcaaacacaaaggaatgcccaaaatgccac
gtcaccattgagaaggacgggggctgcaaccacatggtctgtcggaaccagaactgcaaa
gctgagttctgctgggtgtgtctgggcccctgggagcctcatgggtctgcctggtacaac
tgcaatcgttacaacgaggatgatgcaaaggcagcaagggatgcacaggagagatccaga
gcagccctgcagaggtacctgttctactgcaaccgctatatgaaccacatgcagagcctg
cgctttgagcacaagctctatgcacaggtgaagcagaagatggaggaaatgcagcagcac
aacatgtcatggattgaggtgcagttcctgaagaaagcagtcgacgtcctctgccagtgt
cgtgccacactcatgtacacttacgtctttgccttctacctcaaaaagaataatcagtcc
attatctttgagaataaccaagcagacttagagaatgctacagaggtgctttctgggtac
cttgagcgagatatctcccaagattcactgcaagacataaagcagaaagtacaggataag
tacagatactgcgagagtcgacgaagggttttgttgcagcacgtgcatgaaggctacgag
aaggacctgtgggagtacattgaggactga

DBGET integrated database retrieval system