KEGG   Gallus gallus (chicken): 415348
Entry
415348            CDS       T01006                                 

Symbol
TSPAN3
Name
(RefSeq) tetraspanin-3
  KO
K17293  tetraspanin-3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    415348 (TSPAN3)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   415348 (TSPAN3)
SSDB
Motif
Pfam: Tetraspanin EMP70
Other DBs
NCBI-GeneID: 415348
NCBI-ProteinID: NP_001244187
CGNC: 49965
Ensembl: ENSGALG00000002774
UniProt: A0A1D5P279
Position
10
AA seq 257 aa
MGQCGITSSKTVLVFLNLIFWAAAGILCYVGAYVFITYDDYDHFFEDVYTLIPAVIIIAV
GTLLFIIGLIGCCATIRESRCGLATFVIILLLVFITEVVVVVLGYIYRAKVEDEVDHSIQ
KVYNGYNGTNPDAASRAIDYVQRQLRCCGIHNYTDWENTVWFKQTKNNSVPLSCCKATLS
NCTGSLTRPMDLYSEGCEALVVKKLQEIMMYVIWAALAFAAIQDCKLMRQASETRSLYNP
EEKFLNPESVEKESLQY
NT seq 774 nt   +upstreamnt  +downstreamnt
atggggcagtgcgggatcacctcctccaaaaccgtcttggtcttcctcaacctcatcttc
tgggcagcagcaggcatactgtgctatgtgggagcctatgtgttcatcacatatgacgac
tatgatcacttctttgaagatgtctacacgctcattccagcagttatcatcatagctgtg
ggaacacttctttttattattggacttattggatgctgtgccacgattcgcgaaagtcgc
tgtggactcgctacgtttgtgatcatcctgcttctggttttcattactgaagtggtggtg
gtggttcttggatacatctacagagcaaaggtagaagatgaagttgatcatagcattcaa
aaggtatataacggatacaatgggacaaatcctgatgcagccagccgtgctattgactat
gtacagaggcagctgcgctgttgtgggatccataactacacagactgggagaatactgtc
tggttcaaacaaactaagaacaacagcgtgccacttagctgttgcaaagcaactctcagc
aattgtactggcagtttgacccgtccaatggacctttattctgagggctgtgaggctctg
gttgtaaagaagcttcaagagataatgatgtatgtcatctgggcagcactagcatttgct
gctattcaggactgcaaactgatgcggcaggcttctgaaactcggtctttgtataatcct
gaagaaaaattccttaatcctgagtctgtagaaaaggagtcacttcaatattaa

DBGET integrated database retrieval system