KEGG   Gallus gallus (chicken): 415354
Entry
415354            CDS       T01006                                 

Gene name
NRG4
Definition
(RefSeq) pro-neuregulin-4, membrane-bound isoform
  KO
K05458  neuregulin 4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    415354 (NRG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    415354 (NRG4)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   415354 (NRG4)
SSDB
Motif
Pfam: EGF EGF_2 SH3_2
Other DBs
NCBI-GeneID: 415354
NCBI-ProteinID: NP_001025715
CGNC: 2132
Ensembl: ENSGALG00000002952
UniProt: Q5ZJR0
Position
10
AA seq 112 aa
MRTDHEELCGTSYGSFCLNGGICYMIPTVPSPFCRCIENYTGARCEEVLLPSIKSQTKGD
LFAVLLASLLLLGVLLIGTFYFLCRKATIARTSSSECGAHLVETTSSNGCNK
NT seq 339 nt   +upstreamnt  +downstreamnt
atgcgaacagatcatgaagaactctgtggcaccagttatggatctttttgtctaaatgga
ggcatttgctatatgattcctactgtacccagtccattctgcaggtgtattgagaattac
acaggagcacgctgcgaagaagttttgctgcctagcatcaagtctcaaacaaaaggtgac
ctgtttgcagttctcttggcttcacttctccttctcggagttcttttaattggaacattc
tacttcctttgcaggaaagccaccattgcaaggacaagctcctcagagtgtggtgcccac
ctggttgagactacaagcagcaatggctgcaacaaataa

DBGET integrated database retrieval system