KEGG   Gallus gallus (chicken): 415386
Entry
415386            CDS       T01006                                 

Gene name
APBA2
Definition
(RefSeq) amyloid-beta A4 precursor protein-binding family A member 2 isoform X1
  KO
K20055  amyloid beta A4 precursor protein-binding family A member 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    415386 (APBA2)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    415386 (APBA2)
SSDB
Motif
Pfam: PID PDZ PDZ_6 PDZ_2 NRho
Other DBs
NCBI-GeneID: 415386
NCBI-ProteinID: XP_015134474
CGNC: 2881
Ensembl: ENSGALG00000003930
UniProt: F1NYK4
Position
10
AA seq 755 aa
MANRKRQSTTASMLDHRARACPTSSHNREPENEESDLPVEDYPAKEAELATIRQGSPTPL
EHECNDHSGDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGE
EYAANEEHHIETDECQEAVEEWSEGKIQHQDENEVTDRQEWQEGQDNGIQVLEDEASSLE
IQDQDENIQYCQSEGGYPDYYPAEANGNSQGISPYHSRKEDAELEEQEEDIDQIVAEIKM
SMSMSSINSTTEMSPEHTGTENMAHDYKETCSKGEAVHSANRHEGRPKSLNIPSASKHGG
DVPRGFKAKSRTPEDRQKWPQEQMCNGLEQPRKQQRSDLNGPVDNNNTPESKKVSSFPSF
VDVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIK
KKATSEGDSQALTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRR
MPRSASQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGIN
PEDLSQKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKQKGEILGVVIVESGWGSILPT
VILANMMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSC
PPVTTVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHE
KIVQALSNSVGEIHMKTMPAAMFRLLTGQETPLYI
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggcaaacaggaagcgtcagagcactacagccagcatgctggatcacagagcaagagct
tgcccaacttcatctcacaacagggagcctgaaaatgaggaaagtgatcttcctgttgaa
gattacccagcaaaggaggcagaactagcaaccatcagacaaggcagtcctacacccttg
gaacatgagtgcaatgatcatagtggagatggtgactccagctctgattatgtgaataac
acctctgaggaggaggactatgatgaaggcttgccagaagaagaggaagggatcacatac
tacattagatactgtccagaggatgacagttacctggaaggaatggactgcaatggagaa
gaatatgctgccaatgaggaacaccacattgaaacagatgaatgtcaggaagctgtagaa
gagtggtctgaaggtaaaattcagcaccaggatgaaaatgaggtgacagacaggcaagag
tggcaggaaggtcaagataacggtattcaggttttagaggatgaagcatcatctttggag
atacaagaccaagatgagaatatacaatattgtcaaagtgaaggcggctacccggactat
tacccagcagaggctaatggaaactcacaggggatatcgccatatcattctagaaaagag
gatgcagagctagaagagcaggaagaggacattgaccagattgtagcagaaatcaaaatg
agtatgagcatgagcagcataaatagtacaacagagatgagtccagagcacactgggact
gaaaacatggcacatgactataaagagacttgttcaaagggagaagctgttcacagtgct
aacaggcatgaagggaggccaaaatcactgaatatcccatctgcctctaagcatggtgga
gatgtgcctagaggttttaaagcaaaatcaagaactccggaggacagacagaagtggcca
caagagcagatgtgcaatggtttagagcagccaaggaagcagcagcgttctgacctcaat
ggcccagttgacaataataacacacctgagtcaaagaaggtatcttcatttccaagtttt
gttgacgttccaggaccttgtgaacctgaagatctcattgatggaatcatctttgcagcc
aattacctgggctctacacagctgctctctgagcgcaacccttccaaaaacataaggatg
atgcaggctcaagaggcagtgagccgtgttaagaggatgcaaaaggcggctaaaatcaag
aaaaaagcgacctcggaaggagattcccaggccttgactgaggtggacctgttcatctcc
acacagagaatcaaagttctaaatgcagacacacaggaaacaatgatggatcacgcgctg
cgcacaatctcatacattgctgacattggtaacattgtggttttaatggcacgccgccgc
atgccaagatcagcttctcaagactgtattgaaacaacacctggtgcccaggaaggaaag
aagcagtataaaatgatatgccatgtctttgaatcagaggatgcacagctgatagctcag
tctattggtcaggctttcagtgtggcttaccaggagtttttaagagccaatggaattaac
cctgaggatctcagtcagaaagagtacagtgatatcatcaatacccaggagatgtacaac
gatgatctcatacacttttccaattcagaaaactgcaaagagctccagctagaaaaacag
aagggagaaattcttggtgtagtgattgtggagtctggatggggatctattctacccact
gttatcctggcaaacatgatgaatggaggccctgcagcccgttcaggaaaactaagcatt
ggagaccagattatgtctattaatgggacgagtttagttggcctacctcttgcaacatgc
caagggatcataaagggtctcaagaatcagacacaagtcaaactgaacattgtcagctgc
cctcctgtcactactgtacttataaaacggccagacttgaaataccagttgggtttcagc
gtacagaatggaattatttgcagcttgatgagaggtggaatagctgagaggggaggggtt
agagtgggtcatcgtattattgagatcaatggacaaagtgttgttgcaactgctcacgag
aagatagtacaagcattgtctaattcagtgggagagattcatatgaagactatgccagct
gccatgttcaggcttctaactgggcaagagacacccctatacatctag

DBGET integrated database retrieval system