KEGG   Gallus gallus (chicken): 415395Help
Entry
415395            CDS       T01006                                 

Gene name
THSD4
Definition
(RefSeq) thrombospondin type-1 domain-containing protein 4 isoform X2
  KO
K23377  thrombospondin type-1 domain-containing protein 4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    415395 (THSD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADAM_spacer1 TSP_1 PLAC
Motif
Other DBs
NCBI-GeneID: 415395
NCBI-ProteinID: XP_015134398
CGNC: 2998
Position
10
AA seq 647 aa AA seqDB search
MFVSYLILTLLYFQTAVLARPGGESIGCDDYLGSDKVIDKCGICGGDNTACKVVSGVFKH
TLTNLGYHKIVEIPEGATKINITEMSKSNNYLALRSRSGRSIINGNWAIDRPGRYEGGGT
MFTYKRPNEISSTAGESFLADGPTNEVLDVYMIHQQPNPGIHYEYIIPGDNVISPQLLAH
RRPGEPLNGQLEMPESTNHNEDDLHRETDTLTGQSVGTFPVIPPGRFPSHQPENQVPAVQ
LSRQNREYNWKQIGKTECTTTCGKGSQYPVFHCVNRVTHEEVPENYCDSSTKPIPEEEAC
NIFPCPAFWDIGEWSECSKTCGLGMQHRQILCRQIYANRTLTVQQYRCHHLEKPETTSTC
QLKICSEWQIRTEWTSCSVPCGVGQRTRDVKCVSNLGDVVDDEECNMKLRPNDIENCDMG
PCAKSWFLTEWSDRCSAECGDGIRTRSVVCMTNHVSSLPLEGCGNNRPSETTPCNNGPCA
GKVEWFAGSWSQCSTECGGGTQQREVICVRKTEGNFDVLNPYECSYVERPPSQQSCYLKP
CGSKWFHTEWSTCSKSCEGGFRVREVRCLSDDMTTSTHCDPQLKPEEKEPCNTQDCIPEI
DENCKDKYYNCNVVVQARLCVYTYYKTACCASCTRVANRQSGLLGHR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtcagctacctgatactaacgttgctctactttcaaacagcagtgttagcaaga
cctgggggagagagcattggctgtgacgactatctgggttcagacaaggtgattgacaag
tgtggaatatgtggaggggacaacactgcttgcaaggttgtttctggagttttcaaacac
accctaacaaatctcggctatcacaagatagtggaaattcctgaaggagctactaaaatt
aacattactgagatgtcaaagagcaacaactatttggccttgcggagtcgatcagggcgg
tccatcatcaatggaaactgggcaattgatcggcctggaagatatgaaggtggtgggaca
atgttcacttacaaacgcccaaatgaaatctccagcactgcaggagagtcctttttagcg
gatggtccaacaaatgaagtccttgatgtctatatgatacatcagcagcctaacccaggt
atacattatgagtatatcattccaggagacaatgtcatcagtcctcagttgcttgctcac
aggaggccaggggagcccttgaatggtcagttagaaatgcctgaaagtacaaatcacaat
gaggacgatttgcatagggagacagacactctcactgggcagtcagttggaacgtttcca
gttattccgccaggaagatttccttctcatcagccagaaaaccaggtgcctgctgtgcag
ctatcaagacaaaaccgagaatacaactggaaacagatcggaaaaactgagtgtaccact
acatgtgggaaagggtcccagtacccagttttccactgtgtcaacagagtcacacatgag
gaagttcctgagaattactgtgacagcagcaccaaacctatcccagaagaggaggcctgc
aacatcttcccatgtccagctttctgggacataggggaatggtctgagtgcagcaaaacg
tgcggccttggtatgcagcatcgacagatcttatgtaggcaaatatatgccaaccgcacc
ttgacagtgcagcaataccgctgtcatcacctggagaaaccagagaccaccagcacttgc
cagctgaagatctgcagtgaatggcagattagaacagagtggacttcatgttcagtacct
tgtggagtggggcagaggactcgagatgtgaaatgtgtcagcaaccttggagacgttgtt
gatgatgaggaatgtaacatgaagctgcggccaaatgatattgagaactgtgacatggga
ccttgtgctaagagctggtttcttacagaatggagcgacaggtgttctgcagaatgcggt
gatgggatccgcacacgctcagtggtttgtatgaccaatcatgtcagcagtttgcctctg
gaaggctgtggcaataacagaccctctgaaacaactccctgtaataatgggccctgtgct
ggtaaagtggagtggtttgctgggagctggtcacagtgctctactgaatgtggtggtgga
actcaacagagggaagtcatttgtgtcaggaaaactgaaggcaactttgatgttttgaac
ccctatgaatgctcatatgtggaaagacctcccagccagcaatcctgctacctcaaaccc
tgtggatctaaatggtttcatacagaatggagcacatgttccaagtcctgtgaaggagga
tttagagttcgagaggtacgatgtctatcagatgacatgacaaccagtactcactgtgat
ccacaacttaaacctgaagaaaaagagccatgtaacacacaagactgtatccctgaaata
gatgagaactgcaaagataaatactacaattgcaatgtggtggttcaggcccggctttgt
gtctacacctattacaaaacagcctgttgtgcatcctgtacgcgtgtggcaaatagacag
tctgggcttctaggacacagataa

DBGET integrated database retrieval system