KEGG   Gallus gallus (chicken): 415402
Entry
415402            CDS       T01006                                 

Gene name
AQP9
Definition
(RefSeq) aquaporin-9 isoform 1
  KO
K09877  aquaporin-9
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    415402 (AQP9)
Transporters [BR:gga02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    415402 (AQP9)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 415402
NCBI-ProteinID: NP_001280167
CGNC: 3133
Ensembl: ENSGALG00000004261
UniProt: A0A1D5PEK7
Position
10
AA seq 287 aa
MSRKNKRSLKEKFALKNSLVKEALSEFLGTFIMITLGCGCVGQAVLSRGAHGGPMTISVG
FAMAVTTAVYVSGGVSGGHINPAVSLAMCVAGRLKWTKLPIYILAQFLGAFVGAAAVFGI
YHDAFMEYSNGTLEVTGPYATAHIFATYPAPYLSLINGFADQVMSTAVLLLVIFAIFDTR
NNRVPKGLEPVVVGLLIIVLTCSLGMNSGCAMNPARDLGPRLFTAIAGWGMEVFTAGNNW
WWVPIVAPMLGGVLGALTYIIFIEVHHSDNQQGEENDVYDKYELTNM
NT seq 864 nt   +upstreamnt  +downstreamnt
atgagccggaaaaacaaaaggagtttaaaggagaaatttgccttgaagaacagcttggtt
aaagaagccctttcagaattcctgggaacttttataatgataacactcggatgtgggtgt
gtgggtcaggccgtcctcagccgaggagcccacggtgggcccatgacaatatcggttgga
tttgcaatggctgtcaccacagcagtgtatgtgtctggtggggtttctggtggtcacata
aaccctgccgtttcattagccatgtgtgtggctggaagattaaaatggaccaaattgcca
atttacatattagcacaattcctgggagcatttgttggagcagcggctgtctttgggatt
tatcacgatgcctttatggagtatagcaacggaacacttgaagtcacaggaccttacgca
acagcacatatctttgcaacatacccagctccatatctatccctcataaatggatttgca
gatcaggtgatgtcaacagctgttctacttctggttatatttgctatttttgacaccaga
aataacagagtaccaaagggcctggagccagttgtagtaggacttcttatcatcgttctt
acttgctccttgggaatgaacagtggctgtgccatgaatccagccagggaccttggcccc
aggctcttcacagccattgcaggatggggaatggaagtattcacggctggaaataattgg
tggtgggtccctatcgttgcacctatgctgggaggagtacttggagctcttacctatata
atttttattgaagttcatcactcagataatcaacaaggagaagaaaatgacgtatacgat
aaatatgaactaacaaacatgtag

DBGET integrated database retrieval system