KEGG   Gallus gallus (chicken): 415422Help
Entry
415422            CDS       T01006                                 

Gene name
TMOD2
Definition
(RefSeq) tropomodulin-2
  KO
K10370  tropomodulin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    415422 (TMOD2)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     415422 (TMOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomodulin LRR_6
Motif
Other DBs
NCBI-GeneID: 415422
NCBI-ProteinID: XP_015147449
CGNC: 3514
UniProt: A0A1D5PW62
Position
10
AA seq 351 aa AA seqDB search
MSLPFRKELEKYKNINEDEILSKLSEDELKQLEHVLDDLDPENALLPAGFRQKDQTTKPA
TGPFDRERLLSYLEKQALEHKDREDFVPFTGEKKGKIFIPKEKPIETRTEEKVTLDPELE
EALASASDTELYDLAAVLGVHNMVNNPKFDEGGARSKDGKGSMRNVVKGEKVKPIFEEPP
NPTNVEASLQRIKANDPTLVEVNLNNIKNIPIPTLKEFAKALESNVHVKTFSLAATRSND
PVAIAFADMLKVNKTLKSLNVESNFITGTGILALIDALKENESLTEIKIDNQRQQLGTAV
EMEIAKMLEENSKILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEGERQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgcctttccgaaaggagctggagaaatataagaatatcaacgaagacgaaata
ctcagcaaactctcagaggatgaactgaagcagctcgagcatgttctcgacgaccttgat
cctgagaacgccttgcttccagctggatttcggcaaaaggaccagaccacaaagcctgcc
acgggcccctttgacagagaacgcctgctttcatacttggagaagcaagcgctggagcac
aaggacagggaagactttgttccatttacaggggagaagaaaggaaaaatatttatccct
aaagaaaaacccatagaaactcgtacagaagagaaagtgaccctggatccggagcttgaa
gaagccctggccagcgcttcagatacagagctctatgaccttgcagctgttcttggagtg
cacaacatggtcaacaacccaaaatttgatgaaggaggagcccgcagtaaagatggaaaa
ggaagcatgagaaatgtggtcaaaggtgaaaaggtgaagcccatttttgaggagccacct
aatccaaccaacgtggaagcaagtttacaaaggataaaagcaaatgatcctactctcgta
gaagttaatctgaacaacataaagaatatccctattccaacactgaaagaatttgcaaaa
gccttggaaagcaacgtacatgtgaagacattcagccttgctgctactcgaagcaatgac
cctgtagctattgcatttgcagatatgttgaaagtgaacaaaacactgaagagtctgaat
gtagagtccaatttcatcactgggacgggtattttggcactgattgatgcgctgaaggag
aatgaatccctgacagagattaaaattgacaaccagaggcagcagctggggacagctgtg
gagatggagattgccaagatgctggaggagaactccaagatcctcaagtttggataccag
ttcacaaagcaaggcccacgaaccagggtagcagcagctatcactaaaaacaatgacctg
gttcgcaagaagcgcgtggaaggagagcggcagtag

DBGET integrated database retrieval system