KEGG   Gallus gallus (chicken): 415439Help
Entry
415439            CDS       T01006                                 

Gene name
FGF7
Definition
(RefSeq) fibroblast growth factor 7
  KO
K04358  fibroblast growth factor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    415439 (FGF7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    415439 (FGF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    415439 (FGF7)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    415439 (FGF7)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   415439 (FGF7)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   415439 (FGF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 415439
NCBI-ProteinID: NP_001012543
CGNC: 66242
Ensembl: ENSGALG00000028158
UniProt: Q5KRA4
Position
10
AA seq 194 aa AA seqDB search
MHKWILTWILPILLYRSYFYIIFLMGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDVRVRRLFCRTQWYMRIDKRGKVKGTREANNNYSILEIRTVAVGIVAIKGVESEYFLA
MNKSGRLYGKKVCNEDCNFIELIEENHYNTYASAKWTHKGKEMFVTLNHKGVPMKGKKTK
KEHRASHFLPLAIS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaatggatactgacatggatcctgccaattttgctctacagatcatacttttac
attatctttctaatgggcactatatctttagcttgcaatgacatgactccagagcaaatg
gctacaaatgtgaactgttccagccctgagcgacataccagaagctatgattatatggaa
gggggggatgtaagagtgagaagacttttctgtcgaactcagtggtatatgaggattgat
aagcgaggcaaagtaaaagggacgagagaagcaaacaacaactacagtattctagaaatc
cgaacagtggcagttggaatagtggcaatcaaaggagtggaaagtgaatactttctagca
atgaacaagtcaggaagactctatggaaagaaagtatgcaatgaggattgcaacttcata
gaactaattgaagaaaaccattataatacatatgcttctgcaaaatggacacacaaagga
aaagagatgtttgttacactaaaccacaaaggtgttcccatgaagggtaaaaaaacaaag
aaagaacacagagcatcccactttcttcctctggcaatatcctaa

DBGET integrated database retrieval system