KEGG   Gallus gallus (chicken): 415459
Entry
415459            CDS       T01006                                 

Gene name
RAMAC
Definition
(RefSeq) RNMT-activating mini protein
  KO
K18708  RNMT-activating mini protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    415459 (RAMAC)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     415459 (RAMAC)
SSDB
Motif
Pfam: RAM
Other DBs
NCBI-GeneID: 415459
NCBI-ProteinID: NP_001264036
CGNC: 49987
Ensembl: ENSGALG00000006010
UniProt: E1C6C2
Position
10
AA seq 115 aa
MASLVDIPVDYEKMFAHRFTADDKEYQEYLKRPADPPPIVEEWRNRSGGNQRNRDRFQDG
RYFRGDRYNWQGDHRSNQRPDRGWGNNYQQHRQGQSYYGQYGYNSYNPGPRYHPY
NT seq 348 nt   +upstreamnt  +downstreamnt
atggcttccttggttgacatacccgtggattatgaaaagatgtttgctcatcggttcacg
gcagatgataaagagtaccaggagtacctgaaacgccctgcagatccccctccgatagtt
gaagaatggagaaacagatctggtggcaatcagagaaacagagatcggtttcaagatggc
aggtattttagaggggacagatacaactggcaaggtgaccacagatctaatcagaggcca
gacagaggttggggtaacaactaccagcagcacagacaaggacaatcctactatggacaa
tatggctacaactcctacaacccagggcctcgttaccatccctactga

DBGET integrated database retrieval system