KEGG   Gallus gallus (chicken): 415465
Entry
415465            CDS       T01006                                 

Gene name
ADAMTSL3
Definition
(RefSeq) ADAMTS-like protein 3 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Ig_3 I-set Ig_2 TSP1_CCN ig TSP1_spondin V-set PLAC
Other DBs
NCBI-GeneID: 415465
NCBI-ProteinID: XP_004943881
CGNC: 14232
Ensembl: ENSGALG00000006104
Position
10
AA seq 1775 aa
MASPNGAGLFWEVIWLAIAVYAHLQTRAEQSQGAYFLPEFALSPQGSFLEDTTGEQFLTY
RYDDQTSRITRSDEDKDGSWDAWGAWSDCSRTCGGGASYSLRRCLNGRNCEGRNIRYKTC
SSNDCPSDVGDFRAQQCSAYNDVKYQGHFYEWIPVYNDPTAPCALKCQALGKNLIVELAP
KVLDGTRCNTESLDMCISGICQAVGCDRQLGSNAKEDNCGICAGDGSTCRLVRGQAKAHV
SPEKREETVIAVPHGSRSVRITLKGPAHLVIESKTLQGDKGEHSFEEPGTFVIENTTVEF
QKTTDREIIKIQGPLGADFIIKTRYSGSKDSVVQFFFYQPISHQWRQTEFFPCTVTCGGG
YQLNSAECVDIRLKRVVPDHYCHYYPENKKPKPKLKECNMDPCPSSDGFKEIMPYDHFQP
LPRWEHNPWTACSVSCGGGIQRRSFVCVEETIHGEILQVEEWKCMYAPKPKVIQTCNLFD
CPKWVAMEWSQCTVTCGRGLRYRVVLCIDHRGQHVGGCNPQLKLHIKEECIVPIPCYKPR
EKSPVEAKSPWFKQAHEMEETRAVSEEPTFIPEPWSPCSATCGSGIQVRDVKCRILLSFT
QTEVDLPEEECEDVKPPTEQVCHEAPCDSNPVPYTPEFSRAEDGSVIYDWEYIGFTPCSA
TCLGGTQEAIAMCLHVETKQAVNETLCDNSKRPPPMTHACNMKLCPPRWQTGPWRRCSAT
CGVGIQTRDVYCQQPGGSTVAVEDCKDKKPHSLQACNQIDCPPVWHVEEWQQCSRTCGGG
IQTRKVYCKQLLTDGSFLKHSDDTCREPKLPTTKSCAKVDCPPQLVVGEWSKCSVSCGVG
IQRRKIACQNRTAKGQYVAVNESMCSGLSPSLLVRSCQMNACNKIKPKLPEKYSTHGPRI
IGIHRVYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRRFQKSLIRWEKDEQHLQNSKR
LGITKSGSLKIHSLEAADIGVYRCIAGSAHETFVLKLIGNDNRLIEPPNLRKHASEITNA
DHNEANSFGAKWHKMSKMWQMWSKKNELYLGERQVNDQPFLRNLEAFRSNSAGVFSSREF
KNKRLEAAVLQGAYSMDTAQFEELIRNMSQLIETGEVSDDLASQVIYQLIAELSRPPQST
TEKWKGAQDEKLASKFTGKSPNESDRFSTKTVDKLMSDQKVPVIMRQKEIPGVSFNKTVT
VQIGNTVFLTRNTQSVNLLCETAGISEVKYTWTKDGETLKSSEKVILDTIGKVQIRSPTE
KELGTYGCLVVNDFGFDMETSLLLRAEVPVILFSMLNVTNVEASNLSAVVGGTIVAKIGA
NITIECPVKGVPQPNVTWFMKKGILQINSFLLSNGSLFLRNVSYEDAGTYTCRATNALGK
AEAASVLHLREQRLTENNTLLLKGSRKKRVIMASGIGTNVSVVPGDPLRVGCPVLPSSRN
TVHWLFRGSPIEEVKALEYRVLAGGRILEVNTNSGQFAGRFQCWTSANAKPVSVWVNVKK
EDYKWEYAEWSTCSANCGNSGTRSRKLQCMNSEEQKVNESFCRDLQKPAISYQSCNRDDC
PARWVPGRWSECSATCGSGFRYRQISCQQVKANGSVETVLAGACMHQDRPVGRKPCTGYS
CTAGTTQTKEQCSGSCVGRPVASQHHHFLCRLHNGSLMPNSSCEERKRSAVRRNCSSEVC
DVYWRTGPWRPCSVQCGSGFQSRRVHCVHRKNNKLVADQYCGWKKRPVSWQHCNATACGK
DECKDTTHYCTFAKQLRLCLIDVYKQRCCLSCQEM
NT seq 5328 nt   +upstreamnt  +downstreamnt
atggccagccctaacggtgcagggctcttctgggaggtcatttggcttgctattgctgtc
tacgctcatctccagacgagagcagagcagtcccaaggtgcatacttcttgcctgagttt
gccctttctccacaggggagttttcttgaggataccacaggggaacagttcctcacttac
cgttacgatgaccagacctccagaatcacccgttctgatgaagataaggatggctcctgg
gatgcctggggagcctggagtgattgctcacggacctgcggtgggggagcctcctactca
ctgaggagatgtttaaatggcaggaactgtgaaggtcggaatattcgatacaaaacatgc
agtagtaatgactgcccttcagatgttggtgacttcagagcacaacaatgttcagcctac
aatgatgtcaagtatcaggggcatttttatgagtggatccccgtgtataatgaccctact
gcaccatgtgccttgaagtgtcaagctctgggaaagaacttgattgtggagcttgcccca
aaagtactagatggtactcgctgcaatacggaatcactggatatgtgcattagtggaata
tgccaggcagtaggctgtgatcgacaacttgggagcaatgccaaggaagacaactgtgga
atctgtgcaggagatggttcgacatgcaggcttgtgaggggacaagctaaggcacatgtc
tcaccagaaaaaagggaagaaactgtgattgccgttccacatgggagccgcagtgtgaga
attacactcaaaggaccagcacaccttgttatagagtcaaagacattacaaggagacaag
ggagaacacagttttgaggaacctggaacatttgtcatagaaaatacaactgttgaattt
cagaagactacagatagggaaatcataaagatccaaggacctcttggtgcagatttcatt
atcaagaccaggtactctggatcgaaagacagtgtggttcagttctttttctatcagcct
atcagtcatcaatggagacaaacagagttcttcccctgcacagtgacttgtggaggaggt
tatcagcttaattctgctgaatgtgtggatattcgtctgaagcgtgttgttcctgatcat
tattgtcattattacccagaaaataagaaaccaaagcccaagctaaaagaatgcaacatg
gatccctgtccttctagtgatggatttaaagaaatcatgccatatgatcacttccagcca
cttcctcggtgggaacataacccttggactgcgtgttcagtttcctgtggaggtggtatt
cagaggagaagttttgtgtgtgtagaggagaccatacacggagagattctgcaagtggaa
gaatggaaatgcatgtatgcccctaagcccaaagtcattcaaacctgcaatctgtttgat
tgtcctaaatgggtggcaatggaatggtctcagtgcacagttacatgtggccgaggctta
cgttaccgggtagtgttgtgcattgaccaccgtgggcagcatgttggtggctgtaatcca
caacttaaactacacataaaagaagagtgcatcgtgccaataccatgttacaagccaaga
gaaaaaagtcctgtggaagcaaaatccccatggtttaaacaggcacatgaaatggaggag
accagagcagtctcagaagagccaacgtttattcctgagccgtggtctccatgcagcgct
acgtgtggcagtggcatacaggtgcgggatgtgaagtgccgaattcttctctcatttacg
cagactgaggtggatctgcctgaggaggagtgtgaagatgtgaagccccccacagaacaa
gtatgtcacgaggcaccctgtgacagcaatcctgtcccctacacaccagaattttcacgt
gctgaagatggcagtgtgatttatgactgggagtacattggttttactccttgttcagcc
acctgtcttggaggaacacaagaagccattgcgatgtgtctgcatgtagagacaaagcaa
gctgtcaatgaaaccctgtgcgacaattccaaaagaccaccaccgatgactcatgcttgc
aatatgaagctttgtcctccaaggtggcaaacgggcccatggagacggtgctcagcaact
tgtggagttgggatacagacaagagatgtatactgccagcagcctggaggatctactgtt
gctgttgaggattgcaaagacaaaaagcctcattctttgcaagcttgtaaccagattgat
tgtccccctgtttggcatgttgaggaatggcaacagtgttcccgtacttgtggaggaggg
attcagacccgcaaagtgtactgtaagcagctgttgacagatggaagtttcctgaaacac
tctgatgacacctgccgggaacccaaattgcccactactaaatcatgcgcaaaagtggac
tgtcctcctcagctggttgtaggagaatggtccaagtgctcagtaagctgtggtgttgga
atccagagaaggaaaattgcctgccaaaaccgaacagcaaagggccaatatgttgcagta
aatgaatcaatgtgtagtggtttgtctccttcactgcttgtaaggtcttgtcaaatgaat
gcctgcaacaaaattaaaccaaagcttccagaaaaatactctactcatggacctcggatt
atcggtattcaccgtgtgtatattcagacaagacaagagaagcgcattaattttaccata
ggaagccgtgcctacttacttccaaaaacttctgttgtaattaagtgccccgtacgaaga
ttccagaagtcccttatacggtgggagaaagatgagcaacacttacagaactctaaaaga
ctcggcatcactaagtcagggtcactgaaaatacatagtcttgaagccgctgatattggt
gtgtaccggtgcattgcaggctcagcacatgaaacatttgtactcaaactgattggtaat
gacaacagattgatagaaccaccaaatcttagaaaacatgccagtgagatcactaatgca
gatcacaatgaggccaacagctttggggccaaatggcataaaatgagcaaaatgtggcaa
atgtggagtaagaaaaatgagctctatttgggtgagaggcaagtaaatgatcaaccattt
ctgagaaatcttgaagcctttaggagtaattcagcaggagtatttagctctcgtgaattc
aagaacaaacgtctggaggcagcagttctccagggtgcctacagcatggacacggcacag
tttgaagagctaataaggaacatgagtcaactcattgaaactggagaagtcagtgatgac
ttggcgtcccaggtcatttatcagttaatcgctgagttatctaggcctccgcaatcaacc
actgaaaaatggaagggagcccaggatgagaaattggcctcaaaattcacaggcaaatca
ccaaacgaatctgatcgtttcagcacaaaaactgtggataagttaatgtctgaccagaag
gttccagttattatgaggcaaaaggaaattcctggagtttcctttaacaaaacagtaacc
gtacaaattggaaatacagtttttctgaccaggaatactcaatctgtcaatctactgtgt
gaaacagctggtattagtgaagtgaaatatacttggacaaaagatggtgagacattaaaa
tcctctgaaaaagtgatcctggacaccattggaaaagtgcagattcgcagtcctactgaa
aaggaacttggtacatatggatgtttggttgttaatgactttggttttgatatggaaaca
tctttactattgcgtgcagaggttcctgtcatcttgttctccatgttaaatgttacaaat
gtggaagccagcaatctctctgcagttgttggaggtacaattgtagcaaaaattggagca
aatattacaattgaatgtcccgtgaaaggtgttccccagccgaatgtgacatggtttatg
aagaaaggcatcctacaaattaattctttcttgctttcgaatggctctttatttctgagg
aatgtttcctatgaagatgcaggaacatatacttgcagagcaactaatgctcttgggaaa
gctgaggctgcgtccgttctccacttacgtgaacaaagattaacagagaataatacttta
ctattaaagggaagcagaaaaaagcgtgtcataatggcatctggaattggtacaaatgtt
agtgtggtacctggagatccattaagagtaggttgcccagtgcttcccagctccagaaac
accgttcactggcttttcagaggtagtccaattgaggaagtcaaagccttggaataccga
gtcctggctgggggtcgcatcctggaggtgaacaccaactcgggtcaatttgctgggcga
ttccagtgttggacttcagctaatgcaaaaccagtgtcagtttgggtaaatgtcaagaag
gaagattacaaatgggaatatgcggagtggagcacttgttctgctaactgtggcaattca
ggaacccgctcgaggaaactgcagtgcatgaattcagaggagcagaaagtaaatgaatca
ttttgcagagatctgcaaaagccagcaattagttatcaatcatgcaacagagatgactgc
cctgccaggtgggtacctggtcgatggtctgagtgctctgcaacgtgtggcagtggtttt
cgctaccggcaaataagctgtcaacaagtaaaagccaatggcagcgtggagacagtgcta
gcaggtgcttgtatgcaccaagatcgccctgtgggaaggaagccctgtacgggctattcg
tgtacagcggggacaacgcagacaaaagaacagtgttctggttcctgtgtaggccgcccc
gtagcttcacagcatcaccactttttatgtcgacttcataacggatctttgatgccaaat
tcttcttgtgaagaaagaaagagatctgctgtcagaagaaactgttcctcggaagtatgt
gatgtctattggaggacaggaccttggaggccttgcagtgtgcagtgtgggagtggattt
cagtccagacgagtgcactgtgtacacagaaagaataacaaacttgtggctgatcagtat
tgtggatggaagaagagaccagtgagctggcagcactgcaatgccacagcctgtggcaaa
gatgagtgcaaggatacaactcactactgtacatttgcaaagcagctgaggttgtgcttg
atagacgtctacaaacaaagatgttgtctgtcgtgtcaagaaatgtaa

DBGET integrated database retrieval system