KEGG   Gallus gallus (chicken): 415515Help
Entry
415515            CDS       T01006                                 

Gene name
ADAMTS17
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 17 isoform X1
  KO
K08631  a disintegrin and metalloproteinase with thrombospondin motifs 17 [EC:3.4.24.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    415515 (ADAMTS17)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     415515 (ADAMTS17)
Peptidases and inhibitors [BR:gga01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   415515 (ADAMTS17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_1 ADAM_spacer1 Pep_M12B_propep ADAM_CR_2 Reprolysin Reprolysin_5 Reprolysin_3 Reprolysin_2 Reprolysin_4 PLAC Peptidase_M10 Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 415515
NCBI-ProteinID: XP_015147746
CGNC: 5339
Ensembl: ENSGALG00000038688
UniProt: A0A1D5P6Z0
Position
10
AA seq 1133 aa AA seqDB search
MFDGCLLPLVFPCLLLWGLDAGTAGGAELEVVIPERVALERIHLLPPAGRGDRGGARRRR
ELLRPREAAGEALLLRLPAAGTELYVHLRRDLRFLSRGFVVEHRRGEERRPPAERLCFYT
GRVLNRSDSFASLSTCAGLVGYIQIGSEHMLIQPVNTSETSFSGKEHFIRRRRSTKSSHS
LKSQIPDEHCKVVAEKKRQKKMKSTSDWRERRNAIRLTNEYTVETLVVADADMVQYHGAE
AAQRFILTVMNMVYNMFQHQSLGIKVSIRVTKLVLLRSRPAKLSIGHHGERSLESFCHWQ
NEEYGGAKYLGNNQVPGARDDTPPVDAAVFVTRTDFCVHKDEPCDTVGIAYLGGVCSAKR
KCVLAEDNGLNLAFTIAHELGHNMGMSHDDDHPPCAGRSHIMSGEWVKGRNPSDLSWSSC
SRDDLENFLKSKVSTCLLVTDPRSQYAVRLPHKLPGMHYSADEQCQILFGTNATFCKNME
HLMCAGLWCLVEGDTSCKTKLDPPLDGTECGADKWCRAGECVSKTPIPEHVDGDWSVWSQ
WSMCSRTCGTGVRFRQRKCDNPPPGPGGKNCRGASVEHTVCENLPCPKGVPSFRDQQCQA
HDRYTNKKKSLLTAVVVDDKPCELFCSPLGKDSPVLVTDRVLDGTPCGPYETDLCVHGKC
QKIGCDGIIGSAAKEDRCGICSGDGKTCKVVKGDFNHTKGMVTNSHCKKVSTCVMAKAKA
VPKCFSCYIEAAVIPAGARRIRVVEDKPAHSFLALKDSSKRSINSDWKIELPGEFQIAGT
TVRYVRRGLWEKISAKGPTKIPLHLMVLLFHDQNYGIHYEYTIPVNYTAENRSEPEKQQD
SLYIWTHSGWEGCSVQCGGGERKTIVSCTRIINKTMTVVNDSDCQRVNRPEPQVRKCNTH
PCQSRWVTGLWSPCSATCEKGIQHREVTCVYQLQNGTYVNTRDLYCLGNKPATVQSCEGR
DCLSIWEASEWSKCSADCGKGIQKRTVTCTNSQGKCDAATRPRDEEECEDHTGCYEWKTG
DWSKCSSTCGKGLQSRVVQCMHKVTGRHGSECPVLSKPAAYRQCHQEVCNEKINVNTITS
PRLAALTYKCTGDQWTVYCRVIREKNLCQDMRWYQRCCQTCRDFYANKMQQKS
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacggctgcctcctgcctctcgtgtttccctgcctgctgctttggggactggac
gccggcacagccggcggagcggagctggaagtggtgatcccggagcgagtggcgctggag
aggatccacctgctgccgcccgccgggagaggggaccgcggcggagcccggcgccgtcgg
gagctgctgcggccgcgggaggcggcgggagaggccctgctgctccgcctgcccgccgcc
ggcaccgagctctacgtgcacctccgccgcgacctgcgcttcctctcccggggcttcgtg
gtggagcatcggcgcggggaggagcggcggcccccggcggagcggctctgcttctacacg
ggacgcgtgctgaaccgcagcgactccttcgcctccctcagcacctgcgctgggctggtt
ggctatattcaaattggatcagaacacatgttaatacaaccagtgaatacatcagagacc
tcatttagtggaaaagaacacttcatcagacgtagacgatccacaaaatcaagccattct
ttgaagtctcaaattcctgatgagcactgcaaggttgtagcagaaaagaagaggcaaaag
aagatgaaatcaaccagtgactggagggagagaagaaatgctattcggcttaccaatgag
tacacagtagaaactttggtggtggcagatgctgatatggtccaataccatggtgcagag
gctgcccaaagattcatcctcacagttatgaatatggtgtacaacatgtttcaacatcaa
agccttggaattaaagtcagcattcgagtgacaaaactagtcctacttcgcagtcgacct
gccaagttgtctattgggcatcatggagagaggtctctggagagcttttgtcactggcaa
aatgaagaatatggtggagcaaaataccttggtaacaaccaggttcctggtgcgagggat
gacacccctcctgtggatgctgcagtttttgtaaccaggacagatttctgcgtacacaaa
gacgagccttgtgacactgtgggaattgcttacctaggaggtgtctgcagtgccaagaga
aaatgtgttcttgctgaagataatggtctcaatctggcatttacaattgcacatgaactt
gggcacaacatgggaatgagccatgatgacgatcatcctccctgtgcaggcaggtctcat
attatgtctggagaatgggtcaagggcaggaaccccagtgacctctcctggtcttcatgc
agtcgcgatgaccttgaaaacttcctaaagtccaaggtcagcacctgtttgctagtaaca
gaccctcgaagccaatatgctgtgcggctccctcacaagctgccgggaatgcactacagt
gctgatgaacagtgccagatcctctttgggaccaatgctacattctgtaaaaatatggag
catttgatgtgtgctgggctctggtgcttggtggaaggagatacatcctgtaaaacaaag
ttggatccccctctggatggcactgagtgtggcgcagacaagtggtgccgagctggagag
tgtgtcagtaaaactcccatccctgaacacgttgatggagactggagcgtgtggagtcag
tggagcatgtgcagccggacgtgtggcacaggagtgcgattcagacagaggaaatgcgac
aatccccccccggggccaggtgggaagaactgccgtggggccagtgtggaacacactgtg
tgtgagaacttgccctgccccaaaggtgtgccaagcttcagagaccaacagtgccaggcc
catgacagatacaccaacaagaaaaaaagcctcctgacagctgttgttgttgatgataaa
ccatgtgagcttttctgctctccactggggaaggattcccctgtgctggtgacagataga
gtccttgatggtactccatgtgggccttatgaaactgacctctgtgtacatggcaagtgc
cagaaaattggctgcgatggaatcattggctcagctgccaaagaggatcgctgtggaatc
tgcagtggtgatggcaaaacctgtaaagtggtgaaaggagacttcaaccacacgaagggg
atggtaaccaatagtcattgtaagaaggtttccacatgtgtgatggcaaaggcaaaggct
gttcccaagtgtttctcgtgttacatcgaagcagctgtgatccctgcaggtgcccgacgg
atcagagtggttgaggacaaacctgctcacagttttctggctttaaaagattccagtaag
agatccattaacagcgactggaaaattgagcttcctggtgagtttcagatcgcaggcact
actgtccgatacgtgcgaaggggtctgtgggagaaaatctctgccaaaggaccaactaaa
ataccactgcacttgatggtgctgttatttcatgaccagaattacggaattcattatgaa
tacaccattcctgtaaactatactgctgaaaacagaagtgagccagaaaagcaacaggat
tcattgtacatctggacacacagtggatgggaagggtgtagtgtgcaatgtggaggaggt
gaacggaaaacaattgtgtcctgtactcgaattattaacaagaccatgacagtggtgaat
gacagcgactgccaacgagtgaatcgccctgagccccaggtcaggaaatgtaacacacac
ccctgccagtcacggtgggtgactggcctttggagtccctgctctgccacttgtgaaaaa
ggtatccagcatcgggaagtgacttgtgtttatcagctgcaaaatggcacctatgttaac
acaagagacctctactgccttggcaacaaaccagcaacagtacaaagctgtgaaggacgg
gactgcctctcaatctgggaagcatcagagtggtcaaagtgttcagcagactgtggcaaa
gggatccaaaaaagaacagtgacatgtacaaattctcaaggaaaatgtgatgcagccacc
aggccaagagatgaggaagaatgtgaggatcacacaggctgttatgaatggaaaacaggc
gattggtctaagtgctcctcaacctgtgggaagggcctccagtcacgtgttgtgcagtgc
atgcacaaagtcaccgggcgccatggcagtgagtgtcctgtcctgtccaagccagcggcc
tacaggcagtgtcaccaagaggtctgcaatgagaagattaatgtcaacacaattacctcg
cccagacttgctgctctcacgtacaagtgcacaggcgaccagtggacagtgtactgcagg
gtgatccgggagaagaacctgtgccaagacatgcggtggtatcaacgctgttgccagact
tgcagagacttttatgcaaacaagatgcaacagaagagttaa

DBGET integrated database retrieval system