KEGG   Gallus gallus (chicken): 415568Help
Entry
415568            CDS       T01006                                 

Gene name
TLE3
Definition
(RefSeq) transducin-like enhancer protein 3 isoform X2
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 HALZ Ribosomal_S18
Motif
Other DBs
NCBI-GeneID: 415568
NCBI-ProteinID: XP_015147688
CGNC: 6155
Ensembl: ENSGALG00000008120
Position
10
AA seq 807 aa AA seqDB search
MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELN
AIIGVRGLPNLPLTQQLQAQHLSHAAHGPPVQLPPHPSGLQPPGIPPVTGSSSGLLALGA
LGSQAHLAVKDEKNHHDLDHRERDSSANNSVSPSESLRASEKHRSSTDYSIDSKKRKAEE
KDSMSRYDSDGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARGLKKGDAPNSPASV
ASSSSTPSSKTKDLGHVCAMLCPATGLSKTPLAAGLHSLHFIFLVFFCIQNDKSSTPGLK
SNTPTPRNDAPTPGTSSTPGLRPMPGKPSGMDPLASALRTPISIAGSYAAPFAMMGHHEM
NGSLTSPGAYAGLHNIPPQMSAAAAAAAAYGRSPMVGFDPHPPMRAPGLPTSLASIPGGK
PAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGG
KGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPT
PRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCID
ISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEV
LHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVL
SCDISADDKYIVTGSGDKKATVYEVIY
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgtacccgcagggtcggcacccggccccccaccagccgggccaaccgggcttcaaattc
accgtggccgaatcgtgcgatcggatcaaggacgagtttcagttcctgcaggcgcagtac
cacagcctgaaagtggagtacgacaagctggccaacgagaagaccgagatgcagcgccat
tacgtgatgtactacgaaatgtcctacgggctcaacatcgagatgcacaaacagacagaa
attgctaaaaggctgaataccattttagcacagattatgccttttctgtcacaagagcac
caacagcaagttgcacaggctgttgaacgtgccaagcaagtgacaatgacggagttgaat
gctatcatcggggtacgtggacttcccaatctgcctctcacccagcagctccaggcgcag
cacctctcccacgccgcccatgggcccccggtccagctgcctccgcacccctccggcctg
cagccccccggcatcccacccgtcaccggcagcagttcggggctgctggcgctcggtgcg
ttgggcagccaggcacacctggccgtcaaggatgagaagaaccaccacgacctggaccac
agagagcgggactcgagcgcgaataactccgtttcgccctcggaaagcctgagagccagt
gagaagcaccggagctccacagactacagcattgactccaaaaagcggaaagcagaggag
aaggacagcatgagccgatatgacagcgatggtgacaaaagcgatgacctcgtcgttgat
gtctccaacgaggaccccgccaccccccgggtcagcccggcccactccccaccagagaat
ggcctggacaaagcccgtgggctgaagaagggggatgcacccaacagcccggcctcggtc
gcctcctccagcagcactccctcctccaagactaaagacttgggccacgtatgtgccatg
ctgtgccctgccacagggctctccaaaacccccctggcagctggacttcactctttacat
tttatttttttggtttttttctgcatccagaacgacaaatcatcaacgcccggactcaag
tccaacactcccacaccgaggaacgatgccccaaccccagggacgagcagcaccccgggg
ctgaggccgatgcccggcaagccaagcggcatggacccactggcctcagccctgcggaca
cccatctccatcgcgggttcctacgcagccccgtttgccatgatggggcaccacgagatg
aacggctctctgaccagccctggtgcctatgctggcctgcacaacatccccccgcagatg
agtgctgccgccgccgccgctgctgcctatggccggtcgccaatggttggctttgaccca
cacccacccatgcgggcccctggcctgcccaccagcctggcatccatccctggagggaag
ccagcttactcgtttcacgtcagtgctgatgggcagatgcagccggtcccctttccccac
gacgccctggctggccccggcatcccccggcacgcgcggcagatcaacacgctgagccat
ggtgaggtggtgtgcgccgtcaccatcagcaaccccacccggcacgtgtacacaggtgga
aaaggctgtgtgaagatctgggacatcagccagcctggcagcaagagccccatctctcag
ctggactgcctgaacagggataactacatccgctcctgcaagctgctccccgacggccgc
acgctgatcgttgggggggaggccagcacgctcaccatctgggacctggcctcccccacg
ccccgcatcaaggctgagctcacctcctcggcgcccgcctgctacgcgttggccatcagc
cccgacgccaaagtctgcttctcctgctgcagcgacggcaacatcgccgtgtgggacctg
cacaaccagaccctggtcaggcaattccaaggccacacagacggtgccagctgcatagac
atctcacacgatggtacgaagctgtggacgggggggctggacaacacggtgcgctcctgg
gacctgcgggaagggcggcagctgcagcagcacgacttcacctcccagatcttctcgctg
gggtactgccccacgggagagtggctggcggtgggcatggagagcagcaacgtggaagtg
ctgcaccacaccaagccggacaagtaccagctgcacctgcacgagagctgcgtcctgtcc
ctcaagttcgcctactgcggtaaatggttcgtgagcacggggaaggacaacctgctcaac
gcatggaggacgccctacggggcaagcatcttccagtccaaggaatcctcgtcggtctta
agctgcgacatttcagcggatgacaaatacatcgtcacgggctctggggacaagaaggcc
acagtctacgaggtcatctactga

DBGET integrated database retrieval system