KEGG   Gallus gallus (chicken): 415635
Entry
415635            CDS       T01006                                 

Gene name
POLR2C
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB3
  KO
K03011  DNA-directed RNA polymerase II subunit RPB3
Organism
gga  Gallus gallus (chicken)
Pathway
gga03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    415635 (POLR2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    415635 (POLR2C)
   03400 DNA repair and recombination proteins [BR:gga03400]
    415635 (POLR2C)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     415635 (POLR2C)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      415635 (POLR2C)
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-GeneID: 415635
NCBI-ProteinID: NP_001280231
CGNC: 792
Ensembl: ENSGALG00000001168
Position
11
AA seq 275 aa
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKMQYSRDCTCDEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNNPRVIPVTSRSRDNDPNDYVEQDDILIVKLRKGQELKLKAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSEIDEEDAQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
NT seq 828 nt   +upstreamnt  +downstreamnt
atgccgtacgccaaccagcccacggtgcgcatcaccgagctgacggacgagaacgtcaaa
ttcatcatcgagaacaccgacctggccgtggcgaactccatccggagggtgttcatagcg
gaggtgcccattatagctattgactgggtccagatagacgccaactcctcagtgctccat
gatgaattcattgcccacagactgggtctcatcccactcaccagcgatgacattgtggat
aagatgcagtattccagagactgcacatgcgatgaattctgtccagagtgctctgtggag
ttcacccttgatgtccgctgcaatgaggaccagactcggcacgtcacatcccgtgacctc
atctccaacaatccccgtgtcattccggtgacttctcggagcagagacaacgaccccaac
gactacgtggagcaggatgacatcctgattgtgaagctgcggaagggccaggagctgaag
ctgaaagcctatgccaagaagggctttggcaaggagcacgccaagtggaaccccacagca
ggcgtagcctttgagtacgacccagacaacgcgctgaggcacacagtgtaccccaagcca
gaggaatggcccaagagtgagtactcggagatcgatgaggaggatgctcaggctccatat
gaccccaatgggaagcctgagaggttttattacaacgtggagtcttgcggctctctgcgc
cccgaaaccatcgtcctctctgcactgtccggcctgaagaagaagttgagtgacctccag
acccagctgagccatgagatccagagtgacgtcctcactataaactga

DBGET integrated database retrieval system