KEGG   Gallus gallus (chicken): 415710
Entry
415710            CDS       T01006                                 

Gene name
ESRP2
Definition
(RefSeq) epithelial splicing regulatory protein 2
  KO
K14947  epithelial splicing regulatory protein 1/2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    415710 (ESRP2)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    415710 (ESRP2)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 415710
NCBI-ProteinID: NP_001025737
CGNC: 2457
Ensembl: ENSGALG00000003374
UniProt: Q5ZLR4
Position
11
AA seq 701 aa
MTASHSDSLVVLFGATAGAYGAKLGSDERELILLVWQVVDLPSKKVGTLHKSLVKADNLE
LSDQCREVSGLTAEGLGKAEPLDRVLQQFIQLVSSDLKVFGRNSYTLCSDGQLLIRQVLH
PETSKKNFLLSDCFYSFYDLRKEFHTCYPSSAAVKDQTIKTMAEYLGLGTDEAEEDFGVW
QVKTMVAIIFSMLSENCDHIFTDPETVKYKYETGPCSKSETVDSETVIRARGLPWQSSDQ
DIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFVNSEQRDLALERHKHHMGSRYIEVYK
ATGEEFLKIAGGTSNEVAQFLSKENQVIIRMRGLPFTATQEDVLGFLGPECPVTGGKEGL
LFVKYPDGRPTGDAFVLFSCEEYAQNALKKHKEILGKRYIELFRSTAAEVQQVLNRYMST
PLIPTLPTPIIPVIPPPYTIATGSIRDCVRLRGLPYTAGIDDILDFMGDATADIKPHGVH
MVLNQQGRPSGDAFIQMKSADKAFMVAQKCHKKMMKDRYVEVFQCSGEEMNFVLMGGTLN
RSGLSPPPCLSPPAYAAFQTAAVIPAEAALYQPQALLPTARTPQASAAAPPAVTYYPAQA
AQLYMNYTAYYPSPPVSPTTVGYLAAPPGAVAAAATATHTPLLPQPGALVRMQGLPYNTG
MKEILSFFQGYQYAPDDYNGLIQLSEQARSVLQAPKEWVCL
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgacggcttcgcacagtgactctttggtggtgttgtttggggcaacagctggtgcatat
ggggctaaactgggttcggatgagagggaactaattctcttggtgtggcaagttgtggat
ctccccagcaagaaggtagggacactacacaaatccctggtgaaagcagacaatttggag
ttaagtgaccaatgtcgtgaagtgagtggtttaacagcagagggactgggcaaagctgag
cctctggaccgggttcttcaacagtttattcagctggtatccagtgatttgaaagtattt
ggaaggaactcttacaccctttgcagcgatggccagttactcattcgtcaagtgctccac
ccagaaacatctaagaagaacttcctgctgtcagactgcttctattccttttatgatctg
cgaaaagaatttcacacatgctacccgagttcagctgccgtgaaagaccagactatcaag
accatggcagagtatctaggcttagggacagatgaagcggaggaggactttggcgtgtgg
caagtgaaaacaatggtggctatcattttcagcatgctctctgaaaattgtgatcacata
tttactgaccctgaaactgtgaaatacaagtacgaaacaggtccttgcagcaaatcagaa
acagtggatagtgagactgtaatacgtgctagaggtttgccatggcagtcttcagaccaa
gatattgctcgatttttcaaaggactcaatattgccaaaggtggtgtggccctttgtctg
aatgctcaaggaagaagaaatggtgaagcattagttcgatttgtcaattctgaacagaga
gatctggcactggaaagacataagcatcacatgggtagcagatacattgaggtttacaaa
gcaactggggaagaattcttaaaaattgcaggaggtacctccaatgaagtggcccagttc
ttatctaaagagaatcaagttatcatccgaatgagaggtcttccattcactgctactcag
gaggatgttttgggattcctggggccagagtgtccagtcacaggcgggaaagaaggactt
ctctttgtcaagtatccagatggcaggcccacaggagatgcatttgtgttgttttcctgt
gaagaatatgcacagaatgcacttaaaaagcacaaagaaatacttggaaagcgttacatt
gaactcttcaggagcacagcagcagaagttcagcaggtacttaatcgatacatgtcaaca
cctcttattcccaccctcccaactcctatcattcctgttatacccccaccgtatacaatt
gccacgggtagtatacgggactgtgtccggcttagaggccttccttacactgctggcatt
gatgatatcctggacttcatgggagatgccacagctgatataaagcctcatggagttcac
atggtccttaatcaacagggacgaccatcaggtgatgcttttatccaaatgaaatctgct
gacaaagcctttatggttgctcaaaaatgtcacaaaaaaatgatgaaggaccgttatgtg
gaagtattccagtgttcaggagaggagatgaactttgttttaatgggtggcactttaaat
cgtagtggcttatccccaccgccatgtctttctccaccagcttatgctgcttttcaaaca
gcagctgtgatcccagcagaagcagcgctttaccagccacaagccctcttgccaacagcc
aggactccccaggcctcagctgctgctcctccagctgttacctactacccagctcaggct
gctcagctttatatgaactacacagcttactatcccagtcctccagtatcccctaccaca
gtgggataccttgcagctcctccgggagctgtagctgctgctgccactgccacccacact
ccacttctaccccaacctggagcattagtccgtatgcagggtttgccatataacacagga
atgaaggagattctaagtttcttccagggataccagtatgcacctgatgactacaatggc
cttattcagctgagtgaacaagcaaggagtgtgttacaagcaccgaaagagtgggtctgt
ttgtaa

DBGET integrated database retrieval system