KEGG   Gallus gallus (chicken): 415744
Entry
415744            CDS       T01006                                 

Gene name
DNAJA2
Definition
(RefSeq) dnaJ homolog subfamily A member 2
  KO
K09503  DnaJ homolog subfamily A member 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    415744 (DNAJA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gga03110]
    415744 (DNAJA2)
   03029 Mitochondrial biogenesis [BR:gga03029]
    415744 (DNAJA2)
Chaperones and folding catalysts [BR:gga03110]
 Heat shock proteins
  HSP40 / DNAJ
   415744 (DNAJA2)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    415744 (DNAJA2)
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Other DBs
NCBI-GeneID: 415744
NCBI-ProteinID: NP_001005841
CGNC: 3019
Ensembl: ENSGALG00000004115
UniProt: Q5ZIZ7
Position
11
AA seq 411 aa
MANVADTKLYDILGVPPGASDNELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNP
EKRELYDRYGEQGLREGSGGSSGMDDIFSHIFGGGLFNFMGGQSRSRNGRRRGEDMMHPL
KVSLEDLYNGKTTKLQLSKNVLCSACNGQGGKAGAVQKCNACRGRGVRIMIRQLAPGMVQ
QMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFSGEADQA
PGVEPGDIVLLLQEKENEVFQRDGNDLHMTHKIGLVEALCGFQFTFKHLDGRQIVVKYPP
GKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWISPEKLSELEDLLPARPE
FPNVIGDAEEVDLQEFDTTRGSGGGQRREAYNDSSDEESSHHGPGVQCAHQ
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggcgaacgtggccgacacgaagctgtacgacatcctgggcgtgcctcccggggcctcc
gacaatgagctcaagaaggcttataggaagctagccaaggaataccatcctgataagaat
ccaaatgcaggtgacaaattcaaagaaataagctttgcctatgaagtattgtcaaatccg
gagaaacgtgagttatatgatagatatggagaacagggccttcgagaaggtagtggtgga
agcagtggaatggacgatattttctcccacatctttggtggtggattgttcaatttcatg
ggtggtcagagtagaagtcgtaatggtagaagaagaggagaagatatgatgcatcctcta
aaagtctctttagaagatttatataatggaaagacaactaaactacaacttagcaagaat
gtcctctgtagtgcatgtaatggtcaaggagggaaggctggagctgttcagaaatgtaat
gcttgtcggggtagaggtgtacgtatcatgatcagacagctggctcctggcatggttcag
cagatgcagtctgtatgctctgactgcaatggagaaggtgaagtaattaatgaaaaagac
cgctgtaaaaaatgtgaagggaaaaaggtgatcaaagaggtaaaaatacttgaagtccat
gtagacaaaggcatgaaacatgggcaaagaattacattcagtggagaagcagatcaggct
ccaggtgtggaaccaggtgatattgtcctcttactccaagaaaaggagaatgaggtgttc
caaagggatgggaatgatttgcatatgacgcacaagataggacttgttgaagcactgtgt
ggattccagttcacatttaagcacctcgatgggcgtcagattgtggttaaatatcctcct
ggaaaagtaattgaaccaggttgtgtccgtgtagtcagaggtgaaggaatgccacagtat
cgcaatccttttgagaagggggatctttacattaaatttgacgttcagtttcctgaaaat
aactggattagcccagagaagctttcagaacttgaagatcttctgcctgctagaccagaa
tttcctaatgtaattggtgatgcagaagaggtagatcttcaggaatttgataccactcgt
ggttcaggtggtggccagagacgtgaagcttataatgatagttctgatgaagaaagcagc
catcatggacctggggtacagtgtgcccatcagtaa

DBGET integrated database retrieval system