KEGG   Gallus gallus (chicken): 415797
Entry
415797            CDS       T01006                                 

Gene name
CDH11
Definition
(RefSeq) cadherin-11 precursor
  KO
K06803  cadherin 11, type 2, OB-cadherin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    415797 (CDH11)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Major cadherins
   415797 (CDH11)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_3 Cadherin_2 Cadherin_pro ASFV_J13L Cadherin_4
Other DBs
NCBI-GeneID: 415797
NCBI-ProteinID: NP_001004371
CGNC: 50082
Ensembl: ENSGALG00000039985
UniProt: O93319
Position
11
AA seq 792 aa
MKEDNCLHAALICLGMLYYSHAITTEKLNHVRPSLHGHHEKGKEGQVLHRSKRGWVWNQF
FVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGIIFVIDDKSGNIHATKTLDREE
RAQYTLTAQAVDRNTNRPLEPPSEFIVKVQDINDNPPEFLHENYHANVPERSNVGTSVIQ
VTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKD
MGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIGEN
GLVAYSIIDGDGMDMFEITTDYETQEGVVKLKKVLDFETKKSYSLKVEAANVHIDPKFIS
NGPFKDTVTVKITVEDADEPPVFLKPSYIFEVQENAASGTVVGKVHAKDPDAANSAIRYS
IDRHTDLERYFTINADDGNIKTIKALDREEIAWHNISVFAVEVHKQHQEAKVPVAIKVVD
VNDNAPKFAAAYEAFVCENARSNQQFITISADDKDDSANGPRFIFSLPPEIIHNPNFSLR
DNRDNTASVLVRREGFSRQKQDLYLLPIVISDGGLPPMSSTNTLTIRVCGCDSNGSLLSC
NAEAYILNAGLSTGALIAILACIVILLVIVVLFVTLKRQKKEPLIVFEEEDVRENIITYD
DEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEYQYMPRPGLRPAPNSVDVDDFINTR
IQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYDYLQNWGPRFKKLAD
LYGSKDTFDDDS
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgaaggaggacaattgtttacatgccgctcttatctgcctgggcatgctctattacagc
catgccataactaccgaaaaactaaaccacgtacggccatcgcttcacggtcaccatgaa
aaaggaaaagaaggacaagttttgcatcgttcaaaaagaggctgggtgtggaatcagttc
tttgttatagaagagtacacaggaccagatcctgtactagtgggaaggcttcattcagat
attgattctggagatggaaacattaaatacattctctcaggtgaaggagcaggaatcatt
tttgttattgatgacaaatcagggaacatccatgcaacaaagacactggaccgagaggag
agagctcagtacactctcacggcacaagctgtagacaggaacaccaacagacctttggaa
ccgccctcagaattcattgttaaagtccaagatatcaatgacaacccccctgaatttctt
cacgaaaactaccatgccaatgtgccggagagatcaaatgtgggtacatctgttattcag
gtaacagcttcagatgctgatgatcctacatatgggaacagtgccaaattggtttacagt
attcttgaaggtcagccgtacttctcagtggaagctcaaacaggaattatccgaacggcc
cttccaaatatggacagagaagctaaggaagagtatcacgttgtaatacaggcaaaagat
atgggaggacacatgggaggcctctcagggacaaccaaagtgacaattacacttacagat
gtcaatgacaacccaccaaagtttccacagagtgtgtaccagatgtctgtgtcagaagca
gctgttcctggagaggaagtaggaagagtgaaggccaaagatccagacattggggaaaac
ggcttggtagcttacagcatcattgatggagatggcatggatatgtttgaaattacaaca
gactatgagactcaggaaggtgttgtaaagcttaagaaagtcttggattttgaaaccaaa
aagtcctacagcctgaaggtagaggcagccaacgtgcatattgatccaaagttcatcagc
aatgggccattcaaggacacagtaacagtgaagattacagtggaagacgctgatgagccg
cctgtgtttttaaaaccaagttatatttttgaagtacaggaaaatgcagcatctggtact
gtggttggaaaagtacatgccaaagatcctgatgctgcaaacagtgctataaggtattca
attgatcgtcacactgaccttgaaagatattttactattaatgcagatgatggcaacatc
aagacaataaaagctttggatagggaagaaattgcttggcataatatctctgtctttgct
gttgaagtccacaagcaacaccaggaagccaaagttccagttgcaattaaggttgttgat
gtcaatgacaatgctccaaaatttgcagcagcctatgaagcgtttgtctgtgagaatgct
cgaagcaatcagcaatttattacaattagtgctgatgacaaagatgactcagccaatgga
ccaagatttatcttcagtttaccacccgaaattattcataatccaaatttttccctcaga
gacaacagagataacactgcaagtgttcttgttagacgcgaaggatttagtcgtcaaaag
caagacttataccttcttcctattgtaataagtgatggaggactcccccctatgagcagc
accaacaccctgaccatccgagtctgcggctgtgacagcaatggctccttgctctcctgt
aatgccgaagcctacatcctcaatgcgggattaagcactggagctttaattgccattctt
gcttgcattgtgattttgcttgtcattgtagtgttgtttgtaacactgaaaaggcagaag
aaagaacctctcattgtttttgaagaagaagatgtccgcgagaacattattacttacgat
gatgaaggaggaggagaggaagatactgaagcttttgacatagctactttgcagaaccct
gatggcatcaatggatttattcctcgtaaagacataaaacctgagtatcagtatatgcca
agaccagggcttcgaccagctcccaatagcgttgatgttgatgatttcatcaacacaaga
atacaagaggctgataacgatccaactgcccctccgtatgattctattcagatctatggc
tatgaaggaagaggctcagtggctggttcacttagctcattagagtcagcgacaacagat
tctgatttggactacgactatctacaaaactggggacctcgatttaagaaacttgcagac
ttgtatggctccaaagacactttcgatgatgattcttaa

DBGET integrated database retrieval system