KEGG   Gallus gallus (chicken): 415860
Entry
415860            CDS       T01006                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1 precursor
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04371  Apelin signaling pathway
gga04514  Cell adhesion molecules
gga04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    415860 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    415860 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    415860 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    415860 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    415860 (CDH1)
   04090 CD molecules [BR:gga04090]
    415860 (CDH1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    415860 (CDH1)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Major cadherins
   415860 (CDH1)
CD molecules [BR:gga04090]
 Proteins
  415860 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro He_PIG Filamin Big_9 Gram_pos_anchor
Other DBs
NCBI-GeneID: 415860
NCBI-ProteinID: NP_001034347
CGNC: 377
Ensembl: ENSGALG00000000608
UniProt: P08641 E1C6M9
Position
11
AA seq 887 aa
MGRRWGSPALQRFPVLVLLLLLQVCGQRCDEAAPCQPGFAAETFSFSVPQDSVAAGRELG
RVSFAACSGRPWAVYVPTDTRFKVNGDGVVSTKRPLTLYGRKISFTIYAQDAMGKRHSAR
VTVGRHRHRRHHHNHHLQDTTPAVLTFPKHDPGFLRRQKRDWVIPPISCLENHRGPYPMR
LVQIKSNKDKESKVYYSITGQGADSPPVGIFIIERETGWLEVTEQLDREKIDRYTLLSHA
VSASGQPVEDPMEIIITVMDQNDNKPVFIKEVFVGYIEENAKPGTSVMTVNATDADDAVN
TDNGIVSYSIVSQQPPRPHPQMFTIDPAKGIISVLGTGLDRETTPNYTLIVQATDQEGKG
LSNTATAIIEVTDANDNIPIFNPTMYEGVVEENKPGTEVARLTVTDQDAPGSPAWQAVYH
IKSGNLDGAFSIITDPSTNNGILKTAKGLDYETKSRYDLVVTVENKVPLSVPITLSTASV
LVTVLDVNEPPVFVPPIKRVGVPEDLPVGQQVTSYTAQDPDRDMRQKITYRMGSDPAGWL
YIHPENGIVTATQPLDRESVHAINSTYKAIILAVDNGIPDTTGTGTLLLLLQDVNDNGPT
PEPRSFEICSRQPEKQILSIVDKDLPPHTYPFKAALEHGSSNNWTVEIRGQDELAMGLKK
ELEPGEYNIFVKLTDSQGKAQVTQVKAQVCECEGTAKNCERRSYIVGGLGVPAILGILGG
ILALLILLLLLLLFARRRKVEKEPLLPPEDDMRDNVYNYDEEGGGEEDQDYDLSQLHRGL
DARPEVIRNDVAPPLMAAPQYRPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYE
GGGSEATSLSSLNSSASDQDQDYDYLNEWGNRFKKLAELYGGGEDDE
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgggccggcggtggggttcccccgccctgcagcgcttccccgtgttggtgctgctgctg
ctgctccaggtgtgcggccagcggtgcgacgaggcagccccctgccagcccggctttgct
gcagagaccttcagcttcagtgtgccccaggacagcgtggcggcgggcagggagctggga
cgagtgagctttgcagcctgcagcgggcggccgtgggccgtgtatgtcccgactgacaca
cgcttcaaggtgaacggggatggcgtcgtctcaacaaaacggccactgacgctctatggg
aggaagatcagcttcaccatctacgcacaggatgccatgggcaagaggcactcagcccgg
gtgactgtgggcaggcacaggcaccgccgccaccaccacaaccaccacctgcaggacacg
acgccggctgtgctgaccttccccaagcacgaccccggcttcctccggaggcagaagagg
gattgggtcatcccccccatcagctgcctcgagaaccaccgggggccctaccccatgagg
ctggtgcagatcaaatccaacaaggacaaggagtccaaggtgtactacagcatcacgggg
cagggcgcggacagcccgcccgtgggcatcttcatcatcgagcgcgagacggggtggctg
gaggtgacggagcagctggaccgggagaagatcgatcgctacaccctcttatcccacgcc
gtgtcggccagcgggcagcccgtggaggaccccatggagatcatcatcacggtgatggac
cagaacgacaacaagcccgtgttcatcaaggaggtcttcgtcggctacatcgaggagaac
gcgaagccaggcacctccgtgatgaccgtgaacgccacggatgcggacgatgcggtgaac
acggacaacggcatcgtcagctactccatcgtcagccagcagccgccccgcccgcacccc
cagatgttcaccattgacccggccaagggcatcatcagcgtgctgggcacggggctggac
cgggagaccactcccaactacacactgatcgtccaggccacggaccaggagggcaagggt
ctgtccaacaccgccacggccatcattgaggtcacggatgccaacgacaacattcccatc
ttcaaccccaccatgtacgaaggtgtggtggaagagaataagccaggtacagaggtggcc
aggctgactgtgacggaccaggacgcaccaggctccccagcctggcaagccgtttaccac
atcaagagtgggaacctggatggtgccttcagcattattactgaccccagcaccaacaac
ggaatcctgaagacagccaagggcctggattatgagaccaagagccgctacgacctggtg
gtgacggtggagaacaaagtgcccctgtccgtgcccatcacactctccaccgccagcgtc
ctggtgaccgtcctggacgtgaatgagccccctgtcttcgtgccccctatcaagagggta
ggggtaccagaggacctaccagtggggcagcaggttacatcctacacggcccaagacccc
gacagggacatgaggcagaagatcacgtaccgcatgggcagcgacccagcaggctggctg
tacattcaccccgagaatggcattgtcacggccacccagccactggaccgcgagtcggtg
cacgccatcaacagtacatacaaggccatcatcctggctgtggacaatgggataccggat
accaccggtacggggacgctgctgctgctcctccaggatgtgaatgacaacgggcccacc
ccagagccccggtccttcgagatctgcagccggcagcctgagaagcagatactgagcatt
gtggacaaggacctgcccccacatacctaccccttcaaggcagcactggagcatggttcc
agcaacaactggactgttgagataaggggccaagatgagctggccatgggcctgaaaaag
gagctggagccgggcgagtacaatatctttgtgaagctgacggacagccagggcaaggca
caggtgacgcaggtcaaagcccaggtgtgtgagtgtgaagggacagccaagaactgcgag
cggaggtcgtacatcgtcggtgggctgggtgtccccgccatcctgggcatcctgggggga
atcctggccctgctgatcctgctgctgctgctgctgctctttgcccggcgacgcaaagtg
gagaaggagccgctgctgccgcccgaggatgacatgcgggacaacgtctacaactacgac
gaggagggcggcggcgaggaggaccaggactacgacctgagccagctgcaccgcggcctg
gacgcccgccccgaggtgatccgcaatgatgtggcccccccgctgatggccgccccccag
taccggccccggcccgccaaccccgatgagatcgggaacttcatcgacgagaacctgaag
gcagctgacacggaccccacggcccccccctacgactcgctgctggtgttcgactacgag
ggcggcggctcggaggccacctcgctcagctccctcaactcctccgcctccgaccaggac
caggactacgactacctcaacgagtggggcaaccgcttcaagaagctggcggagctctat
ggcggcggggaggatgatgaatag

DBGET integrated database retrieval system