KEGG   Gallus gallus (chicken): 415944Help
Entry
415944            CDS       T01006                                 

Gene name
BAP1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase BAP1
  KO
K08588  ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     415944 (BAP1)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   415944 (BAP1)
Ubiquitin system [BR:gga04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    415944 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12 Nucleo_P87
Motif
Other DBs
NCBI-GeneID: 415944
NCBI-ProteinID: NP_001025761
CGNC: 3215
Ensembl: ENSGALG00000004366
UniProt: Q5F3N6
Position
12
AA seq 700 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEESRSRR
KVSTLVDETSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCNNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKARNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRL
FELDGLKVYPIDHGPWADDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMK
YESKLHILKMNRQTVLEALQQLIRVTQPELIQSQKSQESQSPEEAKPANSKTVAPESTHP
DGADEPASQGHTTATQSPPTKSKPVAKASASSINGVPPANPNPIVQRLPAFLDNHNYAKS
PMQEEEDLAAGVGRSRVPVRQHQQYSDDEDDYDDDEEEEVRNTNSAIRYKRKGQVKQEHA
AGAADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTTGGGAAVAIVTHSQPSPTPSNE
STDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEEDGLLRIDCLRYNRAVR
DLGPIISSGLLHLTEDGVFCPLAAADGGKSSPPSIKPGEEAQVTIKLDEKEGSEASGSKE
KELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLA
SLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggttggctggagctggagagcgaccccggcctcttcacactgctggtcgaa
gattttggggtcaagggggtgcaggttgaagagatttatgatctgcaaagcaaatgccaa
ggccctgtgtatgggttcatcttcctgttcaagtggattgaggagagcagatcccgccgg
aaggtctctaccctggtggacgagacgtcggtgatcgacgatgacatcgttaataacatg
ttctttgctcaccagctgatccccaattcctgtgccacccatgccctgctgagcgtcctc
ctgaactgcaacaatgttgacctgggccccactctgagtcgcatgaaagatttcaccaaa
ggattcagccctgagagtaaaggctatgccatcggcaatgcccccgagctggccaaggcc
cgcaacagccacgccaggccggagccacggcacttgccagagaaacagaatgggatcagt
gctgtacgaaccatggaggctttccattttgtcagctatgtccctatcaagggacggctg
ttcgagctggatgggctgaaggtctatcccattgaccatgggccctgggctgacgacgag
gaatggacagacaaagccaggagagtgatcatggagcgcatcggcctggctactgcaggg
gaaccgtaccatgacatccgtttcaacctgatggcagtggttcctgatcggaggatgaaa
tatgagtccaagctccatatcctgaagatgaaccgccagacagtgctggaagccctgcag
cagcttatccgagtcactcagcctgagctgatccagtcccagaagtctcaggaatctcag
tctcctgaagaggcaaagccagccaacagcaagactgtggccccagagagtacccatcca
gacggcgctgatgagcctgccagccagggccacaccacagccacgcagagcccacccacc
aaatcaaaaccagtggcaaaggcatcagcgagcagcatcaatggggtgcctccagcaaac
cccaaccccatcgtgcagaggctgccagccttcctggataatcacaactacgccaagtcc
cccatgcaggaggaggaagaccttgcagcaggagtgggtcgcagccgggtcccggtccga
cagcaccagcagtactcagatgatgaggatgactatgatgatgatgaggaggaggaagtt
cgtaacaccaactcagccatcaggtacaaaaggaaggggcaggtaaagcaagagcacgca
gcgggggccgcggatggccagctctccgtcctccagcccaacaccatcaacgtcctggct
gagaagctgaaggagtcccagaaggatctctccattcccctgtccatcaagacgactggc
ggcggagctgctgtggccattgtcactcactcccagccctctcccacccccagcaacgag
agcacggacaccgcctccgagatcggcagcgccttcaactccccactgcgctctcccatc
cgctcggccaaccccacccgtccctccagccccgtcacatcccacatctccaaggtgctg
tttggtgaggaggacggcctcctgcgcattgactgcctgcgctacaaccgggccgtcagg
gacctggggcccatcatcagctctgggctgctgcacctcacagaggacggcgtgttctgc
ccgctggctgctgcagatggggggaaaagctcccccccttccatcaaacccggtgaagaa
gcccaggtcaccatcaaactggacgagaaggagggcagtgaggccagtggcagcaaagag
aaggagctgctggcattgctgaagtgtgtggaggcagagattgcaaactacgaggcttgc
ttgaaggaggaggtagagaagaggaagaaattcaagatcgacgaccagaggagaacccac
aactacgacgagttcatctgtaccttcatctccatgctggcccaggaaggcatgctggcg
agcctcgtggagcagaacatctccgtccgcaggcggcagggggtcagcattggccgtctg
cacaagcagaggaagccggaccggcggaaacgctcccgtccatacaaagccaagcggcag
tag

DBGET integrated database retrieval system