KEGG   Gallus gallus (chicken): 415957Help
Entry
415957            CDS       T01006                                 

Gene name
IARS
Definition
(RefSeq) isoleucine--tRNA ligase, cytoplasmic isoform X2
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    415957 (IARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gga01007]
    415957 (IARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gga03016]
    415957 (IARS)
Enzymes [BR:gga01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     415957 (IARS)
Amino acid related enzymes [BR:gga01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   415957 (IARS)
Transfer RNA biogenesis [BR:gga03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    415957 (IARS)
 Prokaryotic type
   Other AARSs
    415957 (IARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 415957
NCBI-ProteinID: XP_015148966
CGNC: 3573
Ensembl: ENSGALG00000004813
UniProt: A0A3Q2UG33
Position
12
AA seq 1265 aa AA seqDB search
MVQQVPENISFPNEEEKILELWKKLNCFQECLKQSKNRPRFNFYDGPPFATGLPHYGHIL
AGTIKDIVTRFAHQSGFHVDRRFGWDCHGLPVEYEIDKTLGIKGPEDVAKMGIAEYNNQC
RGIVMRYSKEWEFNVTRLGRWIDFENDYKTLYPEFMESVWWVFKQLYDKGLVYRGVKVMP
FSTACNTPLSNFESHQNYKDVQDPSVIVSFPLVEDASVSLVAWTTTPWTLPSNLALCVNP
ELQYVKLRDKATGKIYILMESRLIALYKSDSEYEILDRFPGIVLKGKKYKPLFEYFIQCK
DQGAFTVLVDSYVKEEEGTGVVHQAPYFGADDYRVCMDFNIIQKDSVPVCPVDVSGCFTA
EVTDFAGQYVKDADKNIIKLLKEKGRLVHSSSYKHSYPFCWRSDTPLIYKAVPSWFVRVE
HMVEKLLENNAQCYWVPDFVREKRFGNWLKDARDWAISRNRYWGTPIPLWVSDDFEEVVC
IGSMAELEELSGVKVTDLHRESIDHLTIPSRCGKGVLRRVPEVFDCWFESGSMPYAQVHY
PFENKKELEDAFPADFIAEGIDQTRGWFYTLLVLSTALFGRPPFKNVIVNGLVLASDGQK
MSKRKKNYPDPMAIVNSYGADALRLYLINSPVVRAENLRFKEEGVRDILKDVFLPWYNAY
RFLVQNVHILQHKDEGREFLYNENTVKESNNIMDKWILSFTQSLIQFFKAEMAAYRLYTV
VPRLVKFVDILTNWYVRMNRRRLKGENGTEDCIMALETLFSVLFSMCRLMAPYTPFITEL
MYQNLKTLIDPASVQEKNTESIHYLMLPPVREDLIDRKIESAVSCLQSVIELGRVIRDRK
TIPVKYPLKEVVVIHQDPEALENIRSLEKYILEELNVRQVTLSTNKDKYGVRLRAEPDHM
VLGKRLKGAFKPVMAAIKELKSEQLEEFQETGTIVVEGHELHGEDLRLMYTFDQVAGGSA
QFEAHSDAQVLVLLDVTPDQSMVDEGVAREVINRIQKLRKKRNLVPTDEITVYYRSHPEG
DYLDTVIKEHTDFIFATIKAALKPYPVPTSKEVLIQETTQLKGSELEITLVRGGLCERVG
PACSYVNLKVCVNGTEQDGVLLLENPKGDNTLNLTGLVDAVSCIFGLKNSKLTVFNGKTE
LINKTDLLSLSGKTLHVTTGSAPALINSPDALLCQYINLQLVNAKPQECQKGTVGTLLME
NPVGQNGLTYHGLLHETAKVFGLRSRRLKLFLDEAETQEITKDISMKNLNMKTVYVSVIP
TTAEC
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacaagttccagaaaacataagttttccaaatgaggaagagaagatactggag
ctctggaagaagcttaattgtttccaggaatgcctaaagcagtcaaagaatagacctagg
tttaacttctatgatggccctccatttgctaccgggcttccgcactatggccatattctt
gcaggaaccattaaagacatagttaccagatttgctcaccagagcggttttcatgttgac
agaagatttggatgggattgccatggcctacctgtggaatatgagattgacaagacctta
ggcatcaaagggccagaggatgtggcaaagatggggattgcagaatacaacaaccagtgc
agaggaattgtgatgagatactcaaaggaatgggagttcaacgttaccagattaggacgc
tggattgattttgaaaatgactataaaacactttatcctgaattcatggagtctgtatgg
tgggttttcaagcagctttatgacaagggactggtatacagaggtgttaaagtcatgcct
ttttctactgcttgcaataccccattgtcaaattttgagtcccatcagaattacaaggat
gttcaagacccttcggtgattgtgagtttcccactggttgaagatgcaagtgtctctctt
gttgcttggaccactacaccttggactttacctagcaatctggccctttgtgttaaccca
gaactacaatatgtgaaattgagagataaggctacaggaaagatttacatcttgatggag
tccaggctgatagcactatacaaatctgacagtgaatatgagatactggacaggtttcct
ggcattgttctgaaaggcaagaagtataaaccactctttgagtattttattcagtgcaaa
gatcaaggtgcctttactgtgctagtagacagttatgtgaaggaggaagaaggcacaggt
gttgttcatcaagccccctattttggtgctgacgattacagagtctgtatggattttaat
attattcagaaagattctgtcccagtttgtcctgttgatgtatcaggctgcttcacagct
gaagtgaccgactttgctgggcagtatgtgaaggatgcagataagaacatcattaaatta
ctgaaggagaagggcagactggttcacagcagtagttacaaacatagctatccgttctgc
tggaggtcagatactccgttgatatacaaagctgtgccaagctggtttgtaagagtagag
catatggtggagaagctactggagaataatgcacagtgctactgggttccggattttgtg
agggagaagcgttttgggaactggctaaaagatgcacgagattgggctatatctcgaaac
cgatactggggaacacccatcccactgtgggtcagtgatgattttgaagaggtagtttgt
attggttcaatggcggaactggaagagctgtcaggagtgaaagtcactgatctccatcgg
gaaagtattgatcatctaaccatcccttcacgctgcggcaaaggcgttttgcgccgggtc
cctgaagtttttgattgctggtttgagagtggaagcatgccttatgcacaagtgcattat
ccgtttgaaaacaaaaaagaacttgaagatgcttttccagctgacttcattgctgaaggc
attgaccaaacccgaggatggttctacactttgctggtgctgtccactgctctttttgga
agacctcctttcaagaatgtaattgtaaatggcctagttcttgccagtgatggacaaaaa
atgagcaaaaggaagaagaattatcctgatccaatggctattgtaaatagttatggagct
gatgcactaaggttataccttatcaattctccagtggtaagagcggaaaacttgagattc
aaggaggaaggagtaagggacatactgaaggatgtcttcctgccctggtacaatgcatat
cgctttctagttcagaacgttcacatcctgcaacacaaggatgagggaagagaattcctt
tacaatgagaacacagttaaggagagcaataacatcatggataaatggattctttctttc
acccaatcgctcattcagttcttcaaagctgaaatggcagcttacaggctgtacacggta
gtccctcggttagtgaagtttgtagacattctgaccaactggtatgtgagaatgaatcgc
agaagactgaagggcgagaatgggactgaggactgcattatggccctggaaaccttgttc
agtgttttgttttccatgtgcagacttatggctccgtatactccatttatcactgaactg
atgtaccagaatctgaagacgcttattgatccagcctcagttcaggagaagaatactgaa
agcattcactacctcatgcttcccccagtgagggaggatctgatcgacagaaaaattgaa
agtgctgtttcttgtttgcagtctgttattgagcttggacgagtaatcagagacagaaaa
accattccagtaaagtatcctttgaaagaagtagttgttatccatcaagacccagaggct
ctggaaaacatcaggtctctagagaagtacatacttgaggagctgaacgtacgccaggtg
acgttatccacgaataaagataaatatggagtcaggctgagagcagaaccggatcacatg
gtgcttgggaagcgtttgaaaggtgcatttaagcctgtcatggctgcaatcaaagagctg
aagagtgagcagctggaggaattccaagagacaggcaccattgttgtagaaggacacgag
ctccatggggaggatcttcgtctcatgtatacttttgatcaggttgcaggaggatctgct
cagtttgaggcacattctgatgctcaggttttagttctgctggatgttaccccagaccag
tctatggtggatgaaggagtggcccgggaagtgatcaaccgcattcagaagcttcgcaaa
aagcgaaatctagttcccacagatgagattacagtgtactacagatcacatccagaaggt
gattacttggatactgtcattaaggagcatacagatttcatttttgcaacaataaaggct
gccctgaagccttacccggttcctacctcaaaagaagttctcatccaggagaccactcag
ctgaagggatcggagctagaaattacacttgtcagaggtggtttgtgtgagcgtgttggt
ccagcctgttcctacgtcaacctcaaagtctgtgttaatgggacagaacaagatggtgtg
ttgctgctggagaatccaaaaggagataatacgttgaacctcactggacttgtcgatgca
gtctcctgcatttttggacttaaaaattcaaaactgacagtttttaatggaaaaacagaa
ctgataaacaaaactgacttgcttagtctcagtggaaagactctgcatgtgacaacgggg
tcagcacctgctctcatcaactctcctgatgctcttctctgccagtatatcaacttgcag
ttagtaaatgcaaaaccacaagagtgtcagaaaggaacagtgggaactcttctaatggaa
aaccccgttggtcagaatggattaacataccacggtcttctacatgaaacagcaaaagtt
tttgggctcagaagcaggaggctaaaattgttcctggatgaagcagagactcaggagatc
acaaaggacatctccatgaagaacctgaacatgaagaccgtatatgtcagtgttataccc
accacagctgaatgttga

DBGET integrated database retrieval system