KEGG   Gallus gallus (chicken): 415968
Entry
415968            CDS       T01006                                 

Gene name
ISY1
Definition
(RefSeq) pre-mRNA-splicing factor ISY1 homolog
  KO
K12870  pre-mRNA-splicing factor ISY1
Organism
gga  Gallus gallus (chicken)
Pathway
gga03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    415968 (ISY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    415968 (ISY1)
Spliceosome [BR:gga03041]
 Complex B
  Other components
   Prp19-related factors
    415968 (ISY1)
 Complex C
    415968 (ISY1)
SSDB
Motif
Pfam: Isy1 DUF6494 BCAS3
Other DBs
NCBI-GeneID: 415968
NCBI-ProteinID: XP_414311
CGNC: 3725
Ensembl: ENSGALG00000005012
UniProt: F1P220
Position
12
AA seq 280 aa
MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECNELPKAEKWRRQIIGEISKKVAQI
QNAGLGEFRIRDLNDEINKLLREKGHWEVRIRELGGPDYARIGPRMLDHEGKEVPGNRGY
KYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKSIDAEYYGYRDEDDGILEPLEQEHEKK
VIAEAVEKWKMEREARLARGEEEEEEEENIYAVDDESDEEGGKEKEGEDGQQKFIAHVPV
PSQQEIEEALVRRKKMELLQKYASETLMAQSEEAKRLLGL
NT seq 843 nt   +upstreamnt  +downstreamnt
atggctcggaacgcggagaaagccatgacagccttggcaaggtttcgtcaagctcagctt
gaagaaggaaaagttaaggaacgaagacctttccttgcatcagagtgtaatgaattgcca
aaagctgagaagtggagacggcagatcattggggaaatctccaagaaagtggcacagatt
caaaatgctggattgggtgaattcagaattcgggacctgaatgatgaaataaacaaactt
ctgagggaaaaagggcactgggaagtccgaataagggagctgggaggtcctgattatgct
agaattggaccgaggatgttagatcacgaggggaaggaagttccagggaacagaggttac
aaatactttggagctgcaaaggatttaccaggagttagagaactttttgagaaggagccc
ctcccaccaccccggaaaacccgtgcggaactgatgaaatccattgatgcagaatactat
ggctacagggatgaagatgatggcattctagagcccctggaacaagaacatgagaagaaa
gttatagcagaagcagtggaaaaatggaaaatggagagggaggcaagacttgcgagaggg
gaggaggaggaggaagaggaagaaaatatctacgctgttgatgatgagtctgatgaggag
ggtggcaaagaaaaagaaggcgaagacggccaacagaaatttattgcacatgttccagtg
ccatctcaacaggagattgaggaagctcttgtacggaggaagaagatggagcttcttcag
aagtatgctagtgaaactctgatggcacagagtgaagaagcaaaaagacttctaggatta
taa

DBGET integrated database retrieval system