KEGG   Gallus gallus (chicken): 416009Help
Entry
416009            CDS       T01006                                 

Gene name
ABHD6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     416009 (ABHD6)
Peptidases [BR:gga01002]
 Serine Peptidases
  Family S33
   416009 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Thioesterase DUF1057 DLH Lipase C9orf72-like Esterase
Motif
Other DBs
NCBI-GeneID: 416009
NCBI-ProteinID: XP_004944643
CGNC: 4246
Ensembl: ENSGALG00000005696
UniProt: E1C7P7
Position
12
AA seq 338 aa AA seqDB search
MDLDVLNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRALGMQVRYVNYDDNYQ
FCYSYRGRPGYRPSILMLHGFSGHKDMWLSIVKFLPKNLHLVCVDLPGHEGTTRSALDDY
SIMGQAKRIHQFVECIKLNKRPFHLVGTSMGGNVAGVYAAQYPEDVCSLTLICPAGLPSF
TDSKFVKMLRELKDSERTDRIPLIPSTPEEMADMLKLCSYVRFKVPQQILQGLVDVRIPH
NDFYRKLFLEIVDEKSRHSLHENMNKIKAPTQVIWGKQDQVLDVSGADILASAIPDCHVS
ILENCGHSVVVERPRKTANLILEFLAMLHSAGNSKKQA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgatgtgctcaacatgtttgtcatcgctggcggcaccctggccatccccatc
ctggcctttgtggcctccttcctgctgtggccctctgcactcatccgcatctactactgg
tactggcgtcgagccctgggcatgcaggtcagatacgtaaactatgacgacaactatcag
ttttgttattcctatagaggaagacctgggtaccggccatctatcctgatgctacatggc
ttctcaggccacaaagacatgtggctgtccatagtcaagttcctccccaagaacctgcac
ttggtgtgtgttgacttgcctgggcatgagggcacaacccgctcagccttggacgattac
tccattatgggacaagcaaaaaggatccaccagttcgtggagtgcatcaagctgaacaag
aggcccttccacctcgtcggcacctccatgggtgggaacgtggccggggtttatgccgcg
cagtacccggaggatgtgtgcagcctcactctgatttgtcccgcagggctgccgagcttc
accgacagcaagttcgtcaagatgctccgggagctgaaggactccgagcgcaccgacagg
atcccattgatcccctccacgcccgaggagatggccgacatgctgaagctctgctcctac
gttcgcttcaaggtgccacagcagatccttcagggcctggtggacgtccgcatcccacac
aacgatttctaccgaaaattgtttttagagatcgtggatgagaagtcccggcactccctc
catgagaacatgaacaagatcaaagcaccgacgcaggtcatctggggaaagcaggaccag
gtcctggatgtttccggtgctgacatcttagcaagtgccatcccggactgccacgtgtcc
atcctggagaactgcggccactcggtggtggtggagcggccacgcaagacagcaaacctc
atcctggagttcctggcaatgctgcacagcgcgggcaacagcaagaagcaggcgtga

DBGET integrated database retrieval system