KEGG   Gallus gallus (chicken): 416016
Entry
416016            CDS       T01006                                 

Symbol
RAB7A
Name
(RefSeq) ras-related protein Rab-7a
  KO
K07897  Ras-related protein Rab-7A
Organism
gga  Gallus gallus (chicken)
Pathway
gga04137  Mitophagy - animal
gga04140  Autophagy - animal
gga04144  Endocytosis
gga04145  Phagosome
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    416016 (RAB7A)
   04145 Phagosome
    416016 (RAB7A)
   04140 Autophagy - animal
    416016 (RAB7A)
   04137 Mitophagy - animal
    416016 (RAB7A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    416016 (RAB7A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    416016 (RAB7A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    416016 (RAB7A)
   04031 GTP-binding proteins [BR:gga04031]
    416016 (RAB7A)
Membrane trafficking [BR:gga04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    416016 (RAB7A)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   416016 (RAB7A)
  Exosomal proteins of other body fluids (saliva and urine)
   416016 (RAB7A)
  Exosomal proteins of colorectal cancer cells
   416016 (RAB7A)
  Exosomal proteins of bladder cancer cells
   416016 (RAB7A)
GTP-binding proteins [BR:gga04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    416016 (RAB7A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU cobW Septin ATP_bind_1 PduV-EutP AAA_22 NTPase_1 AAA_16 AAA_7 AAA_24 SRPRB AAA_5 G-alpha ATPase_2 NB-ARC NACHT ABC_tran
Other DBs
NCBI-GeneID: 416016
NCBI-ProteinID: XP_003642026
CGNC: 4408
Ensembl: ENSGALG00000005902
UniProt: E1C0F3
Position
12:complement(9533938..9560436)
AA seq 207 aa
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRVKASAESCSC
NT seq 624 nt   +upstreamnt  +downstreamnt
atgacttctaggaagaaagtgttactgaaagtcatcatcctcggagactctggggtgggg
aagacatcactcatgaaccagtatgtgaacaagaaatttagtaaccagtacaaggctacg
ataggtgcagacttcctgacaaaagaggtcatggtggatgacaggctagtgacaatgcag
atatgggatacagcaggccaagaacgattccagtctctgggagttgccttctacagggga
gcagactgctgtgtgctggtgtttgatgtcacggcccctaacacattcaaaacccttgac
agctggagggacgagtttctcattcaggccagtccaagggatcctgagaactttcccttt
gttgtcctgggaaacaagatcgacctagaaaacagacaagtcaccacaaaacgggcacaa
gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt
aacgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg
gagctttacaacgaattccccgaacccatcaaactagacaagaacgaccgagtgaaggct
tctgcggagagctgcagctgctga

DBGET integrated database retrieval system