KEGG   Gallus gallus (chicken): 416018Help
Entry
416018            CDS       T01006                                 

Gene name
GATA2
Definition
(RefSeq) GATA-binding factor 2
  KO
K17894  GATA-binding protein 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    416018 (GATA2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    416018 (GATA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATA TF_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 416018
NCBI-ProteinID: NP_001003797
CGNC: 4415
Ensembl: ENSGALG00000005909
UniProt: P23824
Position
12
AA seq 466 aa AA seqDB search
MEVATDQPRWMTHHAVLNGQHPESHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYY
ANSAHARARVSYSQAHARLTGSQMCRPHLIHSPGIPWLDSSKAALSAHHHNPWTVNPFTK
TPLHPSAAGAPGAISVYPGSSTSSTASVSSLTPASHSGSHLFGFPPTPPKEVSPDPNSTS
AASPSSSAGARQEDKDSIKYQVSLSEGMKMESASPLRSSLTSMGAQPSTHHPIPTYPSYV
PAAHDYSSSLFHPGSFLGGPASSFTPKPRSKARSCSEGRECVNCGATATPLWRRDGTGHY
LCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACG
LYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGSECFEELSKCMQEKSSPFSAAALA
SHMAPMGHLPPFSHSGHILPTPTPIHPSSSISFGHPHPSSMVTAMG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggccacggatcagcctcgctggatgacccaccacgccgtgctcaacgggcag
caccccgagagccaccacccgggactggctcacaactacatggaaccagcgcagctccta
cctccggacgaagtcgacgtcttcttcaaccacctggattcccagggcaacccttactat
gccaactctgcccatgcccgggcccgggtctcctacagtcaggcacacgcccgcctgacc
gggagtcagatgtgccggcctcatcttatccacagccccgggatcccttggctggacagc
agcaaggcggcactgtctgcccatcaccacaacccctggaccgtcaaccccttcaccaag
acccccctgcacccctcggcggccggagcacctggggccatctcggtgtaccctggcagc
agcacgtccagcaccgcctccgtctcgtcgctcacccccgcctcgcactcgggctcccac
ctcttcggtttccccccgacccctcccaaggaagtgtctccagaccccaactccaccagc
gctgcctccccttcgtcctccgctggggcccggcaggaggacaaagacagcatcaagtac
caagtgtcgctgtcggaagggatgaagatggagagcgccagcccgctccgcagcagcctc
accagcatgggggcccagccctccacccaccaccccatccccacatacccctcttacgtg
ccggctgcccatgactacagcagcagcctcttccacccgggcagcttcctggggggcccg
gcgtccagcttcacccccaagccacgaagcaaggccagatcctgttcagaaggcagagag
tgtgtgaactgtggagcaaccgctacccctctctggagaagagacggcaccgggcattac
ctgtgtaacgcctgcgggctctaccacaaaatgaacggtcaaaaccgacctctcattaaa
cccaaacgaaggctgtcagcggccaggagagcagggacgtgttgtgccaactgtcagaca
accaccacgaccttatggcgacgcaacgccaacggggacccggtttgtaatgcctgcgga
ctctactataaactgcacaatgtgaacaggcctctgaccatgaaaaaggaaggaattcag
accaggaataggaagatgtccaacaaatcaaagaaaagcaagaaaggctctgagtgtttt
gaggaactgtccaagtgcatgcaagagaaatcgtctcctttcagcgccgctgcccttgct
agtcacatggcacctatggggcatttgccaccattcagccactctggacacatcctacca
acacctacccccatccacccatcttccagcatctcatttggacatccgcatccatccagc
atggttacagccatgggataa

DBGET integrated database retrieval system