KEGG   Gallus gallus (chicken): 416024Help
Entry
416024            CDS       T01006                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform 1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00561  Glycerolipid metabolism
gga01100  Metabolic pathways
Module
gga_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    416024 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gga01002]
    416024 (MGLL)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     416024 (MGLL)
Peptidases [BR:gga01002]
 Serine Peptidases
  Family S33
   416024 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase DLH Peptidase_S9 Lipase_3 Abhydrolase_2 Thioesterase PGAP1 Abhydrolase_5 DUF1350 DUF2436 FSH1
Motif
Other DBs
NCBI-GeneID: 416024
NCBI-ProteinID: NP_001264071
CGNC: 4483
Ensembl: ENSGALG00000032736
UniProt: A0A1D5PK92
Position
12
AA seq 311 aa AA seqDB search
MKTGHSSRMPEESSPKRSPQNIPYKDLPHIVNADGQHLFCRYWKPAAAARALVFIAHGAG
EHCGRYDDLAQRLTELNLFVFAHDHVGHGQSEGDRMVVSDFHVFIRDSLQHIDLMKKDHP
GLPILILGHSMGGAISILTASERPGDFSGMLLISPLVVASPEVATPIKVFAAKVLNLVLP
NLSLGSIDPSAISRNKKEMESYTSDPLVYHGGMKVSFVIQLMNAITRIERALPKLTLPIL
VLHGSSDKLCDIKGSYLLMDTVQSQDKTLKVYEEAYHALHKELPEVTTSVFTEILTWVSQ
KVSAAGETSQT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggtcattcatccagaatgcccgaggaaagttcgccaaagcggagtcctcaa
aacatcccatacaaggacctgccccacatcgtcaacgctgatgggcagcacctcttctgc
aggtactggaagccagcagcagctgccagggccctcgtgtttatcgctcatggcgctggg
gaacactgcggccgttatgatgacttggcccagaggctgacagaacttaacttgtttgta
tttgcccatgaccatgttggccatgggcagagtgagggggatcggatggttgtctcagat
ttccacgtcttcatcagggacagcttgcagcacattgatctcatgaaaaaggatcatcca
gggctgcccatcctcatcctggggcactccatggggggagccatctccattctgacagcc
agtgagagacccggtgacttttcaggaatgctgctaatctctcctctggtggttgcgagc
ccagaagttgccactcccatcaaggtttttgcagcaaaagtactcaacctcgtgcttcca
aacttgtcgctgggatccatagatccaagtgcaatttcccggaacaagaaggagatggaa
tcctacacatccgaccccctggtctaccacggtggcatgaaggtctcctttgtcatccag
ctgatgaatgccatcaccagaatcgagcgagctctgcccaagctgactttgcccatcctg
gtgctgcacggctcttctgacaagctctgtgatatcaaaggctcctatttactgatggac
acggtgcagagccaggacaaaacactgaaggtgtatgaggaagcctaccacgcgctgcac
aaagagctgcctgaggtcaccacctccgtcttcacagaaatactgacgtgggtcagccag
aaggtttcagcagctggagaaaccagccagacctaa

DBGET integrated database retrieval system