KEGG   Gallus gallus (chicken): 416030
Entry
416030            CDS       T01006                                 

Gene name
PLXNA1
Definition
(RefSeq) plexin-A1 isoform X1
  KO
K06820  plexin A
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 TIG_plexin PSI YcbB
Other DBs
NCBI-GeneID: 416030
NCBI-ProteinID: XP_004944654
CGNC: 4575
Ensembl: ENSGALG00000006097
Position
12
AA seq 1924 aa
MALARGDAAVMRLLWLKHPLSVNIWTLLLLGSTWLPLAEGSPKSPFRTFSVADWSLTHLV
VHNKTGEVYVGAVNRIYKLSNNLTLLRTHVTGPVEDNEKCYPPPSVQSCPHGLVTTNNVN
KLLLVDYSGNRLIACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVNESGTMSGVIIE
VLNGQNKLFIGTPIDGKSEYFPTLSSRKLMANEENAEMFGFVYQDEFVSSQLKIPSDTLS
KFPTFDIYYIYSFSSEQFVYYLTLQLDTQLTSPDSTGEQFFTSKIVRLCVDDPKFYSYVE
FPIGCVQDGIEYRLIQDAYLTKPGKALAKYLGISEREDILFTIFSQGQKNRVKPPKESVL
CLFTLKKIKDKIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDNFCGQDFNQPLGG
TVTIEGTPLFVDKEDGMTSVAAYDYRGQTVVFAGTRSGRIKKILVDLPADRKHQVLQYEN
VVAHEGSSILRDLVLSPDRQHLYAMTEKQVTRVPVESCEQYESCELCLGSRDPHCGWCVL
HNVCSRKDRCERADEPQRFASELRQCVQLTVQPRNISVTMSEVPLVLQAWNVPDLSAGVN
CSFEDFTESESRIEDGKIYCSSPSAKDVIPITRGRGDKRVVKLYLKSKETGKKFASVDFV
FYNCSVHQSCLSCVNGSFPCHWCKYRHICTHNAADCSFLEGRVKLSEDCPQILPSTQIYI
PVGVVKPITLTAKNLPQPQSGQRNYECIFHIPGSTTRVTALRFNSTSIQCQNTSYFYEGN
DISDLPVNLSVVWNGNFVIDNPQNIQAHLYKCSALRESCGLCLKADPRFECGWCVSEKRC
TLRQHCLAYESSWMHASSGNSRCTDPKITKLSPETGPRQGGTRLTITGENLGLKFEDVRW
GVRVGKVMCIPIESEYISAEQIVCEIGDASPSKVHDARVEVCIRDCSPNYRATSPKSFTF
VTPTFSRVTPARGPLSGGTWIAIEGSHLNAGSNVTVTIGGRPCAFSGRSAREIRCKTPPG
HAPGGSPILININRAELSNPEVKYNYTEDPTIQKIDPEWSINSGGTLLTVTGTNLATIKE
PKIRAKYCSSERENNCTVYNDTTMVCYAPSIDNPERSPPEVGDRPDEIGFIMDNVQALLI
INTTNFVYYPDPVFEPLSPTGMLELKPSSPLILKGRNLLPPAAGNSRLNYTVLIGDTPCT
LTVSETQLLCESPNLTGQHKVTIKAGGFEFSPGTLQIYSDSLLTLPAIIGIGGGGGLLLL
IIIIVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDINELTNDLDGAG
IPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLNKKHFLLTFIRTLEAQ
RSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAE
KMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQI
DYKMLTLNCVNPENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRPKAGDMDLDL
APLLCLALSSKLPANHEPFSLTGTEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQV
TDGSSVALVPKQNSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTK
LWHLVKNHDHMDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALP
LAIKYMFDFLDEQADKHQINDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDAC
LSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKSWVERYYADIAKMPAISDQDMS
AYLAEQSRLHLSQFNSMSALHEIYSYITKYKDEILAALEKDEQARRQRLRSKLEQAIDTM
ALSS
NT seq 5775 nt   +upstreamnt  +downstreamnt
atggccttggccagaggtgacgctgccgtgatgcggctcctttggctcaagcaccccttg
tccgtcaacatttggaccctgctgctcttggggagcacctggctaccgctggcggaaggc
agccccaagtctccctttaggactttctcggttgcagactggagcttgacgcacctggtg
gtccataacaaaaccggggaggtctatgtgggggccgtcaatcggatctacaagctctcc
aataacctcacgctcctgcggacacacgtgacagggcccgtggaggacaatgagaagtgt
taccctccgcccagcgttcagtcctgcccgcacggtctggtcaccaccaacaacgtgaac
aaactgctgctggtggactactcggggaaccgactgatcgcctgcggcagtgcctcgcag
ggtatctgccagttcctgcggctggatgacctcttcaagttgggtgagccccaccaccgc
aaggagcactacctctccagcgtcaacgagtcggggaccatgtctggggtcatcattgag
gtgctgaacgggcagaacaagctcttcattgggacacccattgatggcaagtcggagtac
ttccccacgctttccagccgcaagctgatggccaatgaggagaatgcggagatgtttggc
tttgtctaccaggatgagtttgtctcgtcccagcttaagatcccctcggacacactctcc
aagttccccacctttgatatctactacatctacagcttcagcagcgagcagtttgtgtac
tacctgaccttgcagctggacacccagctcacctcgcccgactccaccggggagcagttt
ttcacctccaagatcgtccgcctctgcgtggacgaccccaagttctactcctacgtggag
ttccccatcggctgtgtgcaggatggcattgagtatcgcctgatccaggacgcttacctg
accaagcccggcaaggctttggccaagtacctgggcatctcagagcgggaggatatcctc
ttcaccatcttctcccagggccagaaaaacagagttaagcctcccaaggagtctgtgctc
tgcctcttcacgttgaagaagatcaaggataagatcaaggaacgtattcagtcatgctat
agaggggaggggaaactctcgctgccctggctcttgaataaggagctgggatgcatcaac
tcgccgctgcagatcgatgacaacttctgtggtcaggattttaaccagccgctcggtgga
accgtcacgattgaggggaccccactttttgtggataaagaggacgggatgacctcagtg
gctgcctatgactacagaggacaaactgttgtgtttgcaggcacacggagcgggaggatc
aaaaagatcctggtggacttgccggctgacaggaagcaccaagtgctgcagtatgagaac
gtggtggcccacgagggcagctccatcctgcgggacctggtgctgagccctgaccgccag
cacctgtatgccatgacagagaagcaggtgacacgggtgccagtagagagctgtgagcaa
tatgagagctgtgagctgtgcctgggctcccgggacccccactgcggctggtgcgtcctc
cacaatgtatgctcacgcaaggaccgctgtgaacgggcagatgagccccagcgcttcgcc
tccgagctgcggcagtgcgtgcagctcaccgtgcagcccaggaacatctcggtcaccatg
tctgaggtcccgctggtcctgcaggcctggaatgtccccgacctctcagcgggagtcaac
tgctcctttgaagacttcactgagtccgagagccgcattgaagatgggaagatctactgc
agctctccctctgccaaggacgtcatccccatcaccaggggccgtggggataagcgggtg
gtgaaactctacctgaaatctaaggagaccgggaagaagttcgcctctgtggatttcgtc
ttctataactgcagcgtccatcaatcctgcctgtcctgcgtgaacggctccttcccctgc
cactggtgcaagtaccgccacatctgcacccacaacgccgccgactgctccttcctggag
ggacgcgtcaagctctccgaggactgcccacagatcctgccctccacccagatctacatc
ccagtgggtgtggtgaagcccatcaccctgacagccaagaacctgccacagccacagtca
ggccagcgcaactatgagtgcatcttccacatccctggcagcaccacccgtgtcaccgct
ctgcgcttcaacagcaccagcatccagtgccagaacacctcgtacttctacgaagggaac
gacatcagtgatctgccggtcaacttatccgtggtctggaatggaaactttgtcatcgac
aacccccagaacatccaagcccacctgtacaagtgctcagccctgcgggagagctgcggg
ctgtgcctgaaggccgacccacgcttcgagtgtggctggtgcgtgtcagagaagcgctgc
acgctgcggcagcactgcctggcctacgagagcagctggatgcacgccagcagcggtaac
agccgctgcaccgaccccaagatcaccaagctgtcacctgagaccggccccaggcaagga
gggacgcgtctgaccatcacgggggagaacctgggcctcaagtttgaagatgtgcgctgg
ggtgttcgagtgggcaaagtgatgtgcatccctattgagagcgagtacatcagcgccgag
cagatcgtgtgtgaaatcggagatgccagcccaagcaaggtccacgatgcgcgggttgaa
gtgtgcatccgggactgctcccccaactaccgggccacctcgcccaagagcttcaccttt
gtgacacccactttctcccgagtgaccccagcccgcggccctctgtctggcggcacctgg
attgccattgaaggaagccatctgaacgctggcagcaacgtcaccgtcaccatcggggga
cgtccctgtgccttttcagggagaagtgcccgtgagatccgctgcaagaccccccctggc
cacgctcctggtgggtcccccatcctcatcaacatcaaccgggcagagctgagcaacccg
gaggtgaagtacaactacacagaggacccgaccatccaaaagatcgatccggagtggagc
ataaacagtggtgggacactgctgactgtgactggcaccaacctggccaccatcaaagag
cccaagatccgagccaagtactgcagctctgaaagggagaataactgcactgtgtacaat
gacaccaccatggtgtgctatgcaccctccattgacaaccccgagcggagccctcctgag
gttggcgaccggccggatgagatcgggttcatcatggataacgtccaggccttgctgatc
atcaacaccaccaactttgtatactacccagaccccgtgtttgagcctctcagccccaca
gggatgttggagctgaagcccagctctcccctcatcctcaagggcaggaacctgctgcct
ccggctgcggggaactcccgcctgaactacacagtgctgattggggacactccctgcact
ctgaccgtgtctgagacccaactgctctgtgagtcccctaacctcaccggccagcacaaa
gtcacgattaaggctggagggttcgagttctccccgggcacgctgcagatctactcggac
agcctgctcaccctgcctgccatcatcgggattggtggtggtggcggcttgctgctgctc
atcatcatcattgtcctcatcgcctacaagcgcaagtcccgcgatgctgaccgcaccctg
aaacgcctccagctgcagatggacaacctggagtcccgggtggccttggagtgcaaagag
gcctttgctgagctgcagacggacattaacgaactgactaacgacctggatggggccggc
atccctttcctggattaccgcacttatgccatgcgggttctgttccctgggatagaagac
cacccggtgctgaaggagatggaggtccaggcaaatgtggagaagtccctgaccctcttt
gggcagctcctgaacaagaagcacttcctgctgaccttcatccgcacgctggaggctcag
cggagcttttccatgcgggaccgtggcaatgtggcctcgctcatcatgacggcactgcag
ggcgagatggagtatgccacaggtgttctgaagcagctcctctctgacctcatcgagaag
aacctggagagtaagaaccatcccaagctgctcctgcggagaacggagtcagttgcagag
aagatgctgacaaattggttcacgtttctgctgtacaagtttctgaaggaatgtgctggg
gagccactcttcatgctgtactgtgccatcaagcagcagatggagaagggacccattgat
gccatcacaggagaggctcgctactctctcagtgaagacaagcttatccggcagcagatt
gactacaaaatgctgaccctcaactgtgtgaaccctgaaaatgagaatgcgccagagatt
cctgtcaaggtgctgaactgtgacaccatcacacaggtgaaagagaagctgctggatgct
gtctacaaaggagtgccctattcccagcgtcccaaagctggagacatggaccttgacctt
gctcctctgctctgcttggctttgtcctccaagctgcctgctaaccatgagcccttctcc
ctcactgggacagagtggcggcagggcaggatggcccggatcatactgcaggatgaagat
gtcaccacaaagattgacaatgactggaagaggctaaacaccctggcccactaccaggtg
acggatggctcctcagtagccctggtgcccaagcagaactctgcgtacaacatctccaac
tcctcaaccttcaccaagtccctcagcagatatgagagcatgctccggacagccagcagc
cccgacagcctgcgctcacgcacccccatgatcaccccggacctggagagtggcaccaag
ctttggcacctggtaaaaaaccacgaccacatggaccagcgggagggtgaccggggcagc
aagatggtctctgagatctacctgacccgcctgctagccaccaagggcaccctgcagaaa
tttgtggatgatctgtttgagactatcttcagcacagcacatcgtgggagcgcactgccc
ctcgccatcaaatacatgtttgatttcctggatgagcaagctgataagcaccagatcaat
gattatgatgtcaggcacacctggaagagtaactgtctacctctacgtttttgggtgaat
gtgattaagaacccccagtttgtgtttgacattcacaagaacagtattactgatgcctgc
ctatccgtggtggctcagacattcatggactcctgctcaacttctgagcacaaattagga
aaagactctccctccaacaaactactgtacgccaaggacatccccaactacaagagctgg
gtagaaagatattatgcagatattgctaaaatgccagcaattagtgaccaggacatgagc
gcctacctggcagagcagtcacggttacacctcagccagttcaacagcatgagtgcgctg
cacgagatctactcctacatcaccaagtacaaggatgagattttagccgcgttagagaag
gacgagcaggccaggaggcagcggctgagaagtaagctggagcaggcaattgacacgatg
gccttaagcagctga

DBGET integrated database retrieval system