KEGG   Gallus gallus (chicken): 416083
Entry
416083            CDS       T01006                                 

Symbol
MAGI1
Name
(RefSeq) membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 isoform X4
  KO
K05631  atrophin-1 interacting protein 3 (BAI1-associated protein 1)
Organism
gga  Gallus gallus (chicken)
Pathway
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    416083 (MAGI1)
SSDB
Motif
Pfam: PDZ PDZ_6 MAGI_u5 MAGI_u1 PDZ_2 WW Guanylate_kin DUF6288 Tricorn_PDZ Serglycin
Other DBs
NCBI-GeneID: 416083
NCBI-ProteinID: XP_015148750
CGNC: 5607
Ensembl: ENSGALG00000007431
Position
12
AA seq 1455 aa
MSRVVQKKNHWASRVRQCVLSRGPGGQLGFVLLGGAEHGEFPYAGAVAAGGGEQALSEGE
LLLEVQGVRVSGLPRYDVLEVIRSCKEPIVVKAVRQGSRLNKDLRHYLNQRFQKGSPDHD
LQQTIRDNLYRHAVPCTTRPPREGEVPGVDYNFLTVEEFLELERSGTLLEVGTYEGNYYG
TPKPPSQPLSGKVTSTDALQNLQSGSKQSTPKRTKSYNDMQNAGIVHTENEEEDDAPEMS
SSFTAESGDQDEHHTHIVRETAPPSAIDSHTNLPTTEPSQSLPQYLPPSAEDNLGPLPEN
WEMAYTENGEVYFIDHNTKTTSWLDPRCLSKQQKPLEECEDDEEGVHTEELDSELELPAG
WEKIEDPVYGVYYVDHINRKTQYENPVLEAKRKKQLEQQQQQPPEEWTEECPSLPPPAAP
NLVSNNQEAVREAPVQGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQI
KSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPL
PFDPDDPNTSLVTSVAILDKEPIIVNGQENYDSPASHSSKTGKVNGTKEARPSSPAEVSS
NGPHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADSPGGGGQRVKQIVDSPRCR
GLKEGDLIVEVNKKNVQSLTHNQVVDMLIECPKGSEVTLLVQRGGLPVPKKSPKSQALER
KDSQNSSQHSVSSHRSGHTASPAHSTQVLPEYPAAEPPAADQPDASGQKKPDPFKIWAQS
RSMYESRPMSPSPATGLSKGEREREINSTSFGEFPDYQEQDIFLWRKETGFGFRILGGNE
PGEPIYIGHIVPLGAADADGRLRSGDELICVDGTPVVGKSHQLVVQLMQQAAKQGHVNLT
VRRKVVYTVPKAENEVPSPASSHHSSNQPASLTEEKRTPQGSQNSLNTVSSGSGSTSGIG
SGGGGGSGVVSTVVQPYDVEIRRGENEGFGFVIVSSVSRPEAGTTFAGNACVAMPHKIGR
IIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNAT
LLTNAEKIATITTTHTPQQIPQETSRNNTKPKQESQFDFKPPQAAQQDQDFYTVELERGA
KGFGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEILEINGETTKNMKHARAIELI
KNGGRRVRLFLKRGDGSVPEYDPSSDRNSPATGSQNVSEMKPVPSDRRQHPSLESSYPPD
LHKSSQHGDKRTYVRDLKGSREVSRHPNEHHTWNGTCKANDTVPGRRTERSPERRRERQP
ERVAVNGQKRRSPEKQRREGTRSADNTLERRERHERRRDLSPERRRERSPGRRRRSLERL
TEPRRSPERRRENSLDRRAKSSDRRRERSPERRLREERAGHRQREDASWKQEASRRHPTE
QRRRPYKECSTDLSI
NT seq 4368 nt   +upstreamnt  +downstreamnt
atgtcgcgggtcgtccagaagaagaaccactgggccagccgggtgcggcagtgcgtgctg
agccgcgggcccggcgggcagctgggcttcgtcctgctgggcggcgcggagcacggcgag
ttcccctacgcgggcgcggtggcggcgggaggcggcgagcaggcgctgagcgagggggag
ctgctgctggaggtgcagggggtgcgcgtctccgggctgccgcgctacgacgtgctggag
gtgatccggagctgcaaggagcccatcgtggtgaaagccgtcagacaaggaagcagactg
aacaaagacctgagacattatctcaaccagaggtttcagaaaggatcgccggatcacgat
ctacaacagactattagagataacctttatcgccatgctgtgccttgcacaacccgccct
ccgagagaaggagaagtgcctggtgtggactataactttctgactgtggaggagtttctg
gagttggagcgaagtgggacccttctggaagtaggaacctatgaaggtaactattatgga
acgcccaagcctcccagccagcccctcagtgggaaagtgacttccaccgatgctctgcaa
aacctgcagtctggctccaagcagtcaactccaaagcgaaccaagtcttacaatgatatg
caaaatgctggcatagtgcacacagagaatgaggaagaggatgatgcacctgaaatgagc
agtagcttcacagcagagtctggtgaccaagacgagcatcacacgcatatcgtcagagag
acagccccaccgtctgcgattgatagccacaccaatcttcccaccacggaaccatctcag
agcctccctcaatacctacctccttctgccgaggataacctaggtcctctgccagaaaac
tgggagatggcctacaccgagaacggagaagtctattttatagaccataatacaaaaaca
acgtcttggctagatccacggtgcctgagcaaacagcagaagcctctagaagaatgtgaa
gatgatgaagaaggggtacacacggaggaactggacagtgaactagagttgcctgctggt
tgggagaaaattgaggatcccgtatatggtgtctactatgtagaccacatcaaccggaag
acacaatatgagaacccggttcttgaagcaaagaggaagaagcagcttgaacaacaacag
cagcagccaccagaagaatggacagaggagtgtccatctctcccaccacccgctgctcca
aaccttgtttcaaacaaccaagaggcagttcgggaagcaccagtgcaagggaaacctttt
tttacaagaaacccttctgagttgaaagggaagttcatccacaccaagctaaggaaaagc
agcagggggttcggcttcaccgtcgtcggaggagatgagccggatgaatttctgcagatc
aaaagtttggtgcttgacggccccgcggcactggacggcaaaatggagacaggggacgtc
atagtcagcgtgaacgacacctgcgtgttggggcacactcacgcccaagttgtgaaaatc
ttccagtccatccccattggtgccagcgtggacctcgaactgtgccgaggctaccccctg
cccttcgatcccgacgaccccaacacaagcctggtgacgtccgtggcaattttggacaaa
gagccgatcattgtgaacgggcaggaaaattatgactccccggccagccacagtagtaaa
acagggaaagtcaatggcacaaaggaagcgagacccagcagcccagctgaggtctcctcc
aacggaccccatgggtaccccaatgacacagtctctttggcgtcttcaatagcaacacaa
cctgaactgataaccgtgcatatagtgaaagggcccatgggctttggctttactatagca
gacagtcccggtgggggtggccaaagggtgaaacaaattgtggacagcccacgatgccga
ggcctgaaggagggtgaccttatagttgaagtcaacaagaagaatgtgcagagcctcact
cacaaccaggtggtggatatgctgattgaatgtcccaagggaagcgaggtcacgttgctg
gtgcagcgaggaggactgccggtcccaaagaagagcccaaagtcgcaagcacttgaaagg
aaagacagccaaaacagttctcagcacagcgtctccagccaccgcagcgggcacaccgcg
tcccccgctcacagcacgcaggtgctgccggagtaccccgccgccgagccgccggctgcc
gaccaacccgacgcttctgggcagaaaaagccagatccattcaaaatctgggcccagtcc
aggagcatgtatgaaagccgacctatgtcaccttcgcctgcaactggactgagcaagggt
gagagagagagagaaatcaattccacgagttttggagaatttccagattaccaagagcag
gatatctttctatggagaaaggaaaccggttttggatttaggattctgggtggaaatgag
cctggagaacctatttacatcggtcacattgtaccattgggtgctgctgatgctgacggc
cgcctgaggtcgggtgatgagctgatctgcgtggatgggacgcctgtagtcgggaaatca
caccagcttgttgtccagcttatgcaacaggcggccaagcaaggccacgtcaatctgacc
gtcaggcgcaaagtagtttacacagtccccaaggcagaaaacgaagtcccatccccagcc
tcttcccaccacagcagcaaccagccggcctcgctgacagaggagaagcgaacgccgcag
ggcagccagaactccctcaacaccgtcagctcgggcagcggcagcaccagcggcatcggc
agcggtgggggaggcggcagcggcgtggtcagcaccgtggtgcagccctatgatgtggaa
atccgccgtggtgagaacgagggcttcggcttcgtcatcgtctcgtcggtgagcagaccg
gaggcagggacgacgttcgcgggaaatgcatgtgtggccatgcctcacaaaataggtcgg
attattgaagggagtcccgcagaccgctgtggcaagctgaaagtaggcgatcgcatcttg
gccgtcaatgggtgctccatcaccaacaagtcgcattcagacatcgtcaacctcattaag
gaagcgggaaacaccgttactctgcgcatcattccaggagacgaatcctccaatgctact
ttattgaccaatgcagaaaaaattgctacaattacaactacacatactcctcagcaaata
ccacaggagaccagcaggaacaacacaaaaccaaagcaggaatcccagtttgatttcaaa
ccaccccaagcagcacagcaggaccaggatttttacactgttgagctggaaagaggagcc
aaagggtttggcttcagcctgcgaggtggccgggagtataatatggatctgtacgtgctg
cggctagctgaggatgggccagctgagagatgtgggaagatgaggattggtgatgaaatc
ctagagatcaacggggaaactaccaagaacatgaagcatgctcgggccatcgaactgatt
aaaaatggtggccgcagggtccgcctgtttctgaaacgtggagatggctctgtcccagaa
tatgaccccagcagtgacaggaacagtcccgccacaggttcacaaaatgtatcggaaatg
aaacccgtgccatccgaccgacggcagcacccatcattggagtccagttatccaccagac
cttcacaaatcatcacaacatggggacaagcggacttacgttagagacctaaaaggcagc
agagaggttagcagacatcccaacgaacaccacacttggaacgggacttgtaaagccaac
gacaccgtgccaggcaggaggacagagcggtcaccggagaggagacgcgagaggcagccg
gagagggtggcggtgaatgggcagaagaggaggtcacccgaaaagcagcgcagggaaggg
acgaggagtgccgacaacaccctggagagacgggagcggcacgagaggaggagagacctc
tccccagagagacgcagggagcggtcacccggccggcgccggcgctcgctggagagactc
acagagcccaggaggtcaccagagcggagaagggagaactccttggatcggcgagccaag
tcatccgaccggcggagagagcggtcgcccgagcggcggctcagggaagagcgggccggc
caccggcaaagggaagatgccagctggaagcaggaggcgagccgccggcacccaaccgag
cagcgcaggcggccctacaaggagtgcagcaccgacctcagcatctga

DBGET integrated database retrieval system