KEGG   Gallus gallus (chicken): 416102
Entry
416102            CDS       T01006                                 

Gene name
CHL1
Definition
(RefSeq) neural cell adhesion molecule L1-like protein isoform X1
  KO
K06758  L1 cell adhesion molecule like protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    416102 (CHL1)
Cell adhesion molecules [BR:gga04515]
 Immunoglobulin superfamily
  L1 family
   416102 (CHL1)
SSDB
Motif
Pfam: Ig_3 I-set fn3 Ig_2 ig Bravo_FIGEY V-set C2-set_2 Pur_ac_phosph_N Ig_6
Other DBs
NCBI-GeneID: 416102
NCBI-ProteinID: XP_004944754
CGNC: 5984
Ensembl: ENSGALG00000037856
UniProt: A0A3Q3B104
Position
12
AA seq 1225 aa
MAMLLSTKRITICLFFFVRSLAAATEIPLSVAQLPTITEQSETQVAYPFDENFTIKCEAS
GNPQPTFNWTKDGKPFDLLSDPRIISRNNSGTFVIQNHGIITNFQGKYRCYASNVLGTAM
SKEIELIVPSVPKFPKEKIEPLDVEHGDSVILHCNPPKGIPPLHIYWMNIDLQHIPQDER
VSMSLKGDLYFANVEENDSRSDYCCFAAFPKLRTIVQKMPMTLKVSRFKHANDSGSPNAA
VTKANFIKERKPKLLIPPESAGSSSSVTVIKGGVLQLECIAEGLPTPHLSWVKVTGSLPK
DKPVTDKFGKVLKIENVSAADEGTYQCTASNPVGRAKHEFHVHVEEPPRWIKEPRGGVYS
LGENLLLLCEAIGNPEPTIQWKLNGMPIDSRTFRGRISDGELSLINLQLQDTAVYHCEAS
NKHGTLLASANVNVLNIAPLILTSDGENYAAVVGYSAFLHCKIFASPAADVRWTKDDSIE
PLSALRYELNKNGTLEIKETKKEDSGSYACWAANSVGKRAITANLDIRDATKIVITPKNP
QVLKSHSILLKCQSEYDSHLKNSFKLSWRKDGYELSVSSIQDSRIVMDMDTLFISNVMLE
DQGVYTCVASTSLDSVTAKTRLIVLDVPDPPEDLQLSEHQNRSVRLSWKAGASHNSPVNE
SIIEFEESRWEPGRWQELARAPGNTTTTLLSLAPYTNYQFRVVSVNAVGRSQPSKPSLRY
ATPPAAPDKNPENIRVEASEPNEMVMKWEPLKPMERNGPGLEYKVSWRQQGVETEWNEET
VKKHSLTLRNTPTFVPYEIKVQAINNLGAGPEPNITTGYSGEDIPDAAPSGVSVDIVNST
LVKVFWFGIPRDRVRGHLRGYKVSWWKTKSMLDGKRHHPEKHFLTFVGDRNYGMIPGLEP
FSEFRLAVLAYNSKGDGPESAPVVFETPEGVPEQPHFLKILNFDKDSVTLSWGLPKRANG
HITGYVLQYQIINETHEIGPLMDISVANHTTLNWRLTDLSPSTKYKFYVKACTAKGCGKP
VTEEGLTVAQGSKGIGKNSEAVNPTQKFHPIEALEPGTEYTVRLVTKNWVDNNSIFEDVI
ETRGRAYAGIYDGISTQGWFIGLMCAIALLTLMLLTICFVRRNKGGKYSVKEKEDLHPDP
EAQSIKDEIFGEYSDSDEKPLKGSLRSINGDIKATESADSLVDYGEGEHGMFNEDGSFIG
AYAGSKEKGSVEGNGSSTATFPLHA
NT seq 3678 nt   +upstreamnt  +downstreamnt
atggcgatgctattaagcacaaagaggatcaccatatgcctgtttttctttgtacggagt
ttggcagcagctactgaaataccgttatcagttgcacagcttccaacaatcacggagcaa
tctgaaacccaggttgcctacccttttgacgagaactttacaattaaatgtgaagccagt
ggaaacccgcagcccactttcaactggacaaaggatggaaaaccatttgatctgttatct
gatcccaggataatctcacgtaataactctgggacatttgtgattcagaaccatggaatc
atcaccaatttccaagggaaatatcgttgctatgcatccaatgtgctgggaactgccatg
tcaaaagaaattgaactcattgttccaagtgtaccaaaattccctaaagaaaagatagag
ccccttgacgtggagcacggtgattctgtgatcttgcactgtaacccccctaaagggatc
ccacctttgcatatctattggatgaatattgatttgcagcacattcctcaagatgaaagg
gtctccatgagccttaagggagatctctactttgcaaatgtggaagaaaatgacagccga
agtgattattgttgctttgcagcgtttccaaaactgaggacaattgtacagaaaatgcca
atgacactgaaggtctcccgttttaagcatgctaatgactcaggctcacctaatgctgca
gttactaaggcaaattttattaaagaaagaaaacccaaactgctgatccctcctgaatct
gctggcagcagctcatcagtcactgttatcaagggaggtgtcctgcaactcgagtgtatt
gctgaagggctcccaactcctcatctaagctgggtcaaagttactggaagcttgcccaag
gacaaacctgtaacagataaatttgggaaggtactgaagatagaaaacgtgtctgcagct
gatgaaggaacctaccagtgcacagcaagcaaccccgtgggcagagcaaaacatgaattc
catgttcatgtggaagagcctcctcggtggattaaggagcccagaggtggtgtttacagc
ttaggagagaatcttttgctgctttgtgaggccatcggcaacccagagccaaccattcag
tggaaacttaacgggatgcccattgatagtaggaccttcagagggagaatctctgatggg
gagctcagccttatcaaccttcagcttcaggacactgctgtgtaccattgtgaggccagt
aacaagcatggcaccctccttgctagcgccaacgtgaatgtcctcaatattgctccctta
atcctgacttcagatggtgaaaactatgctgcagttgttggttacagtgccttcctgcac
tgcaaaatttttgcctcgcctgcagcagatgttagatggactaaggatgatagcatagag
ccactctcagcattacgctatgaattaaataaaaatggcaccctagaaatcaaagaaaca
aagaaggaagattcgggatcatacgcttgctgggctgcaaattctgttggaaaaagagca
atcacagcaaatctggatataagagatgctacaaaaattgtcattactccgaagaacccc
caagtgttgaaatcacattcaattttactgaaatgtcagtctgagtatgattcacacttg
aaaaacagcttcaaattatcctggaggaaagatggatatgagctgtcagtcagcagcata
caagacagcaggatagttatggacatggatacgctgttcatatcaaatgtgatgttggag
gaccaaggcgtttacacgtgtgtggctagcacttctcttgacagtgtcactgccaaaacg
cggttaattgttcttgatgttcctgacccaccagaagacctgcagctctcagaacatcaa
aaccgaagtgttcgactgtcttggaaagctggggccagccacaacagccctgttaatgag
tcgattatagagtttgaagagagccggtgggagccggggaggtggcaggagctggcccga
gccccagggaacaccaccaccaccctcctgtccttggccccatacaccaattaccagttc
cgtgttgtgtctgtgaacgctgttggaaggagccagcccagtaaaccatctctgcgctat
gcgacacctccggctgctccagacaagaacccagaaaacatccgagttgaagcttctgaa
ccaaatgaaatggtgatgaaatgggagccactgaagcccatggagcgaaacgggccaggg
ctggagtacaaagtcagctggaggcagcagggtgttgagaccgaatggaatgaggaaaca
gtgaagaagcactccctgaccctgaggaacacccccaccttcgtgccctacgagatcaag
gtccaagcaataaataatttaggagctgggcctgaaccaaatattaccactggatattcg
ggagaggacattccagatgccgctccttccggcgtctcggtggatattgtcaacagcacg
ctggtcaaagtcttctggtttggaataccaagggacagagttcgtggacatttaagaggc
tataaggtcagttggtggaaaacaaaaagcatgctggatggaaaaaggcatcacccggag
aaacacttcctgacgtttgtaggagacagaaactatgggatgatccctggtctggagccc
ttcagcgaattccgcttggctgtgctggcgtacaactccaagggtgatggaccagaaagt
gctcctgtggtgtttgaaactccggaaggagtccctgaacagccccattttctgaagatc
ctgaactttgataaggactctgtcaccctatcatggggacttcccaagagagccaatggc
cacattactggctacgttttgcaataccagataataaatgaaacacatgagattgggcct
ctgatggacatcagtgtggccaaccacaccaccctgaactggaggctcacagacctcagc
cccagcaccaagtacaagttctacgtcaaggcctgcacagccaagggctgtgggaagcca
gtgacagaagaaggcctgacagtggctcaagggagtaaagggatcggcaagaattcagaa
gcagtaaaccccacccaaaagtttcaccccattgaggcacttgagcctggaactgaatat
acagttcgtctagtgactaagaattgggttgataacaatagcatttttgaagatgtaatt
gagacgagggggagagcctatgcaggcatttacgatgggatttccacccagggctggttt
attggactgatgtgtgccattgccttgctcactctgatgctgctaactatttgctttgtc
agaagaaataaaggaggaaaatactcagtgaaagaaaaagaagatttgcatccagaccct
gaagctcaatcaataaaagatgaaatctttggggaatatagtgacagcgatgaaaagccg
ctgaaaggcagcctgcggtccattaacggggacattaaagccactgaaagtgctgatagt
ctggtagattatggagaaggggagcacgggatgttcaatgaagatggttcatttattgga
gcttatgctggatctaaggaaaaaggatcagtcgaaggcaatgggagctctacagcaact
tttcctctccacgcataa

DBGET integrated database retrieval system