KEGG   Gallus gallus (chicken): 416129Help
Entry
416129            CDS       T01006                                 

Gene name
MRPS25
Definition
(RefSeq) 28S ribosomal protein S25, mitochondrial
  KO
K17404  small subunit ribosomal protein S25
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gga03011]
    416129 (MRPS25)
Ribosome [BR:gga03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    416129 (MRPS25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 416129
NCBI-ProteinID: NP_001264769
CGNC: 6451
Ensembl: ENSGALG00000008506
UniProt: E1BSI6
Position
12
AA seq 173 aa AA seqDB search
MPMKGRFPVRRTLQYLSQGDVIFKSSVKVMTVNYNTAGEPSEGARKFVFFNIPQIQYKNP
WVQIMLLRNMTPSPFLRFYLDSGEQVLVDVEDKTNKEITEHIKRILGKSKETLEKEERER
EKLSHPATFGPKKYHLRECMCEIEGQVPCPAFVPLPKEMRGKYKACLKNESSA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgaagggccggttccccgtgcggcggacgctgcagtacctcagccaaggcgat
gtcattttcaagagctccgtgaaggttatgaccgtgaactacaacacggcgggggaaccg
agcgagggggcgagaaagtttgtgtttttcaacatcccccagatccagtacaaaaacccc
tgggtgcagatcatgctcctcaggaacatgacgccttcgccgttcctccgcttctacctc
gatagcggagaacaagttttggttgatgtggaagataaaaccaacaaggagataactgaa
cacattaaaagaattctgggcaaaagcaaagaaacacttgaaaaagaggaaagagagaga
gaaaaactgtcacatcctgcaacttttgggcccaagaagtatcatctgcgagagtgcatg
tgtgaaattgaaggccaggttccttgccctgcctttgtgccactgcccaaagagatgaga
ggaaaatataaagcttgtctgaaaaatgaatcatctgcctga

DBGET integrated database retrieval system