KEGG   Gallus gallus (chicken): 416159
Entry
416159            CDS       T01006                                 

Gene name
ATP10B
Definition
(RefSeq) probable phospholipid-transporting ATPase VB isoform X1
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    416159 (ATP10B)
Enzymes [BR:gga01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     416159 (ATP10B)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Hydrolase Cation_ATPase E1-E2_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 416159
NCBI-ProteinID: XP_004944865
CGNC: 1162
Ensembl: ENSGALG00000001662
UniProt: E1BX05
Position
13
AA seq 1476 aa
MSRRSFPGCFSKMIWKKHFFKETCCRCIASDTETQNEVLEKRGKLKKRRKKNENKRVIIS
NLSFGSTKWKENPNRYYDSNKIKTTKYSVLTFFPKNLYEQLHRFANIYFVVIALLNFVPV
VNAFQPEVSLIPICVIMAMTAIKDAWEDFRRYKLDKEINHMGCYVYSRKDRAYVEKCWKD
VRVGDFVQLQCNETIPADILLLYSSDQNGICHLETANLDGETNLKQRRVVMGFSSQNTSF
EPEFFQNTIICELPNNDLNKFKGYMEQPNHERIGFNIESLLLRGCTIRNTEVAIGIVIYA
GHETKAMLNNNGPRYKRSKIERRMNVDIFLCVGLLFTMCLVGSIGHGIWSGSFPEHPPYD
VPDENGNFLSPVLSGFYMFLTMIILLQVLIPISLYVSIELVKLGQVFLIHNDLDLYDEEA
DLPIQCRALNITEDLGQIQYIFSDKTGTLTENKMVFRRCTVDGHEFSHQENAKRLETHKE
LDLEDEDFAKLQHFTLPPMNIERPATYQRTMRPLRRSQSARAHFQGHTRSRSLGRRDSNQ
SQVAFSSTIEKDVTPDSRLLRRVREAALRTENISPFIHMKTATSLTDFFLALAICNTVVV
STTTEPRQRVTVPPPIKPSGITLEKIHQIFQRLKLVSLSQSFSSSQSSSDLGASFSAKNT
EEHLATLDCCDNDDGYCDSSRGAGLQDKSSRDIGSASLDEVFQSVTHGTLPTDFCYEAES
PDEAALVYAAQAYSFTLVSRTPEQVTVRLPQGTLLTFDILYTLGFDSVRKRMSVVVRHPL
TKEIIVYTKGADSVIMDLLEDPGKADTNAERRMKRIKDKTQKHLDCYARDGLRTLCIAKK
VLSEDDFQKWANFRQEAEAAIDNRDELLMETAQHLETKLTLLGATGIEDRLQDGVPDTIA
ALREAGIQIWVLTGDKQETAVNIAYSCKLLDQRDTVFTINTENKETCESLLNLTLEEVRK
NYEVEKPRRKLFGFIPTSLPASETPGPEFGLVIDGRTLDIILQGGLEERFLELARLCRSV
LCCRSTPLQKSMVVKLVRRQLKVMTLSIGDGANDVSMIQAADVGIGISGQEGMQAVMASD
FAISRFKHLKKLLLVHGHWCYTRLAKMVIYFFYKNVSYVNLLFWYQFFCGFSGNTMIDYW
QMIFFNLFFTSLPPLVFGVLDRDVSAETLLSLPELYKNGQNSEIYKLSTFIITMLDAFYQ
SLVCFFVPYLAYKDSDIDVFSFGNPINTVSLLTILLHQALEMKTWTLFHWITIIGSVVIY
LVFSLIYNAVCVACNPPTDPYWIMEKQLSEPSFYLLCLITPAIALLPRYFIFALRGTLGA
SLILKAQQLDKLPKGQRDCEIQKLRSRKQTTSDAPVASPAPNEDLDQSIGHLCFSPFLHP
AAASVPQVDAGSQGLLASEVNPLRKWAHEEGYYFFNRWAEEESTATDSSAGPLSGHCPLV
PSGITSPGQDGDKLTKGKAKNFNCGSHRRSVSAVTL
NT seq 4431 nt   +upstreamnt  +downstreamnt
atgtcaaggagaagttttccaggctgcttctctaagatgatatggaaaaaacattttttc
aaggaaacctgctgtcgatgcattgcttcagacacagaaacccaaaacgaagtgctggag
aagagaggaaaattaaagaaaagaagaaagaaaaatgaaaataagcgagtgatcatctcc
aatttgtcttttggaagtacgaagtggaaggaaaatccgaacagatactatgactccaat
aaaattaagaccacgaaatacagcgtcttgactttcttccctaaaaacctctatgagcag
cttcaccgctttgccaatatttattttgtggtcattgcactgctgaattttgtgccagtg
gtgaatgctttccaaccagaagtttctttgatccctatttgtgttataatggccatgaca
gccattaaagatgcttgggaggactttcggcggtataagctagacaaagaaatcaatcac
atgggttgttacgtttacagcaggaaagaccgtgcctatgttgagaagtgctggaaagat
gtccgagtgggagattttgtgcagctgcagtgtaacgagaccatcccagctgatatcctc
ttgctgtactcctctgaccagaatgggatttgccacttggaaacagccaaccttgatggc
gagaccaaccttaagcagcgacgagttgtcatggggttctccagccagaatacttcattt
gaaccagaatttttccaaaataccatcatctgtgaattgcctaataatgatctcaataaa
ttcaaagggtacatggaacagccaaatcatgaacggattggttttaacatcgaaagcctt
ctgcttcgtggatgtacaatcagaaacactgaagtcgcaataggaattgttatatatgca
ggtcatgaaaccaaggccatgctgaataacaatggtcctcgctacaagcgcagcaagata
gagcgacggatgaatgtggatattttcttgtgtgtgggactcctgttcacgatgtgtctt
gttggatctatagggcatggcatttggtctggaagcttcccagaacacccaccttatgat
gtcccagatgagaatggcaattttctgtctccggttctttctggcttctacatgttcttg
actatgataatcttgttgcaggttttgatccccatttctctttatgtgtccattgagtta
gtcaagttgggccaagtcttcttaatacacaatgaccttgacctgtatgatgaagaagca
gatctgcccatacagtgccgagccctaaatattactgaagatcttgggcaaatccagtat
attttctcagacaaaactgggactctaacagaaaacaaaatggtattccgacgctgtact
gtggatggacatgagttttcacatcaggaaaatgccaagcgcctggaaacacacaaggag
ttggacttagaagatgaggactttgcaaaacttcagcacttcacacttcctccaatgaat
attgaaagaccggccacttatcagaggaccatgagacctttaaggaggtcccagagtgct
agggctcattttcaggggcatacaaggagcagatcacttggtcgtcgtgatagcaaccaa
tctcaagtggctttcagcagtaccattgagaaggatgtgactccggatagcaggctgctg
aggagagtgagggaagctgcactgcggactgaaaacatctctccttttatacatatgaaa
actgccacctctctcactgacttttttcttgcccttgctatctgcaatacagtcgtggtc
tccacaactactgagccaagacaaagggttacagtcccaccaccaataaaaccttcagga
atcaccctggagaagattcatcagatatttcagcggctgaaactagtaagccttagccag
tctttttcatcttctcagtctagttcagacctaggagctagcttcagtgcaaagaacacc
gaggagcatcttgctacgctggattgctgtgacaatgatgacggctactgtgacagcagt
aggggcgctgggctccaggacaagagcagcagagatattggcagtgcttccttggatgag
gtttttcagtccgttactcatggtactttgccaacagacttttgttatgaggctgagagc
ccagatgaggcagcacttgtctatgccgcccaggcatacagttttactttagtgtcccgg
actcccgaacaggtgaccgtacggttgccacagggcacacttctaacttttgatattctc
tacactttgggatttgattcagtaaggaaaaggatgtctgtagtggtgagacaccctctg
accaaggagattattgtctacacaaaaggagctgactctgttataatggacttgttggaa
gaccctggcaaagctgacactaatgcagagaggagaatgaaaagaataaaagacaaaaca
cagaaacatttggactgctatgcacgtgatggcctccgaactctgtgcatagctaagaag
gtcttgagtgaggatgactttcaaaaatgggccaattttcgtcaggaggcagaagctgca
attgacaacagagatgagctgttaatggagacagcacagcatctggagaccaaactcacc
ttgctgggagcaacagggattgaagatcggctgcaagatggagtgcctgacactattgct
gcgcttcgagaagctgggatacagatctgggtgctgacaggagacaaacaggaaacagca
gttaacattgcgtattcctgtaagctcctggaccaaagggacaccgtcttcaccattaac
acagaaaataaggaaacttgtgaatcgctcttgaatttaaccttggaagaagtgaggaag
aattatgaggttgaaaaaccacgaaggaaactttttggctttatcccaacatctttacca
gcctctgagacgcctggccctgaatttgggctggtgattgacggaagaacactggacatt
atcctgcaggggggtctggaggagcggttcctggagctggcgcggctctgccgctcggtg
ctgtgctgccgttccaccccgctgcagaagagcatggtggtcaagctggtgcggaggcag
ctcaaagtgatgaccctgtccataggtgatggtgcaaatgatgtaagtatgattcaagca
gctgatgttggaattggaatatctggccaagaaggcatgcaggctgtgatggctagtgac
ttcgcaatatcccgatttaagcatctcaaaaagctgcttctcgtccatggacattggtgt
tacactcgcctggcaaagatggtgatttactttttctacaaaaatgtgagctacgtcaac
ctgctcttctggtaccagttcttctgcgggttctcaggcaacacaatgatagattattgg
cagatgatatttttcaatcttttcttcacctcattgccccctctggtctttggagttctg
gatagagatgtttctgcagaaacactcctgagcttgcctgagttatacaagaatgggcag
aattcagagatatacaagctgtcgacttttattattacaatgttggatgccttctatcaa
agccttgtctgcttctttgtcccctatttggcatacaaggattctgacatcgatgtgttt
tcctttggaaaccccatcaatactgtttccctcctgaccatcctcttgcaccaggctcta
gaaatgaaaacatggacactgttccactggatcacgataattgggagcgtggtaatttac
cttgtcttctctctgatctacaatgccgtgtgcgtggcctgcaaccctcccaccgacccc
tactggataatggagaaacagctttcagagcccagcttctatttactgtgtcttatcacc
ccagccatcgcactcttgccaaggtactttatctttgctcttcgaggaacccttggagca
tccctgattctgaaagctcagcagttagataaacttcctaaagggcaacgggattgtgag
atacagaaactgaggtcaagaaaacaaactacttctgatgcacctgtagcatcaccagca
cctaatgaggaccttgaccaaagcatcggccacttatgtttttcaccatttttacatcca
gcagcagcatctgtgcctcaggtggatgcaggaagtcagggacttttggcctctgaggtg
aatcctctcaggaaatgggcacatgaggaaggatactatttctttaacaggtgggcagag
gaagaatctactgctacagactcttcagcaggacctctctctggccattgccccctagta
cccagtggaataacatctcctggacaggacggtgacaaactaactaaaggaaaagctaag
aattttaattgtggaagccatcggcgatctgtgagtgcagtgacactttga

DBGET integrated database retrieval system