KEGG   Gallus gallus (chicken): 416161
Entry
416161            CDS       T01006                                 

Gene name
CCNG1
Definition
(RefSeq) cyclin-G1
  KO
K10145  cyclin G1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    416161 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 416161
NCBI-ProteinID: XP_414493
CGNC: 1203
Ensembl: ENSGALG00000001718
UniProt: E1BUH6
Position
13
AA seq 295 aa
MIETLVSSDARALLYQLTALLEHELRCQPKGSGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFHTETFSLAVNFLDRFLSKMKVQPKHLGCVGLSCFYLAVKATEEERNVPLATD
LIRISQYRFTVSDMMRMEKIVLEKLSWKVKATTAFQFLQLYHSLIHENLSCERKRYLNFE
RLETQLKACHCRIMFSKAKPSVLALSIMALEIEEQKLLELTEALEFLQLHSKINSRDLTF
WKELVLKCLTEYSSSKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPETSS
NT seq 888 nt   +upstreamnt  +downstreamnt
atgattgagacgcttgtgagcagcgatgcccgggcgctgctgtaccagctcacggctctg
ctggagcacgagctgcggtgtcagccgaagggctcgggcctgaggctgatcgagtctgcc
catgacaacggcctccgaatgaccgcaaggctgcgagacttcgaagtgaaggacctgctc
agcttaactcagttcttcggcttccacacggagaccttctcgctggccgtcaacttctta
gatagattcctgtccaaaatgaaggtacagcctaaacacttgggctgtgttggactgagc
tgcttctacctggctgtgaaggcaacagaagaagagagaaacgttcccttagccaccgac
ttaattcgaataagccagtataggttcactgtttctgatatgatgagaatggagaaaatt
gtattggagaagctttcttggaaagtcaaagcaacaacagccttccagttcctacagctt
tatcactcactcattcatgagaatttaagctgtgaaaggaaaagataccttaattttgag
agacttgagacccagcttaaggcatgtcactgcagaatcatgttttctaaagctaagcct
tctgtcttagcactgtctattatggcactagagatagaagaacaaaaactactggagttg
acagaggcattggaatttctgcagttgcattccaagataaacagcagagacttgaccttc
tggaaggaattggtgttgaagtgccttacagaatattcctcgagcaagtgttccaaacca
aatgtccagaaattaaaatggattgtgtctggacgtacagcacggcagcttaaacatagc
tattatagaataacacaccttcctacaattccagaaaccagctcataa

DBGET integrated database retrieval system