KEGG   Gallus gallus (chicken): 416172
Entry
416172            CDS       T01006                                 

Gene name
SPDL1
Definition
(RefSeq) protein Spindly isoform X2
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Uso1_p115_C
Other DBs
NCBI-GeneID: 416172
NCBI-ProteinID: XP_004944844
CGNC: 1371
Ensembl: ENSGALG00000001942
UniProt: E1BW90
Position
13
AA seq 608 aa
METETILNLRQQLKEAENERRKAAQYGLHLLESQNEIQNQLDQMRRELTEKTEKFEQEKY
SLQREIELKNRMLESLSFECDALKQQQNVQLDKQKEHLARVHGQEVNDLKHKLENLKAEL
DETRLSEKQLRHKVDCQKEIIAAKTEELHMMSERVHETMSSEMLNLQMELTELESVKANV
EEKLNELQYSKEQLELINSNLRNQLERLQGEKEEREKEVVSYCNALEKAREANQELRVQL
DHVVQQSLDPTSKGNSLFAEVEDRRAEMERQLISVKIKYQSLQKQHAFTREQLQRMKLQM
ATLLQMKGSQAEFEQLERLQSMLEQKNGEIENLLVKVRQLEKFKTLYENMEECRASTSSK
GGESEDGYYADLLQMKLDNSNKETETLKNELSLQRMKALYESQRVLEVERKLFTNERHLQ
ACQSENMNLRVMLDELKMKYEPEELLKVTKIKKRREKIPVDATCEYLDSKNTSVDEAPLT
HLPSKEEAKMTSNNLEQIDSSSRKQALEASPINIALQSMDKVVEPERERKRVKTKDDSVD
TCASYSRGGSNFLTSSAPRLTTESRFEATEIEDKKENVITTKKKTQKKKYTTLYVSSKPT
PETQCAQQ
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggagacagagaccattttaaatcttagacagcaactgaaagaagcagagaatgagcga
agaaaggctgcacaatatggcttacacttactggagtctcaaaatgaaattcaaaatcag
ttggatcaaatgcgtcgtgaattaacggagaagactgagaaatttgaacaagagaaatat
tctcttcagagagaaatcgaacttaagaataggatgttggaaagcctgagttttgaatgt
gatgccctcaagcaacagcaaaatgtgcaactggataaacagaaagaacaccttgccaga
gttcatggacaagaagtcaatgaccttaaacacaagttggagaacctgaaggcagaacta
gatgaaacccggctctctgagaaacaattgagacacaaagtggactgtcagaaggaaata
attgcagccaaaacagaagagctacacatgatgtctgaacgtgtgcatgaaaccatgtct
tcagaaatgctcaatcttcagatggagctcacagaactagaaagtgtgaaggccaatgtt
gaagaaaagctgaatgaactgcagtacagcaaagaacaactagaactcataaatagtaac
ttacgtaatcagctggagcgtctacaaggagaaaaagaagagagggagaaagaagttgtt
tcttactgtaatgcactagagaaagctcgtgaagctaatcaggagcttcgggttcagctg
gatcacgtggtgcagcaatctttggaccctacaagtaaaggcaattctctctttgctgag
gtggaggaccgtagggcagaaatggaacggcagctgatcagtgtgaaaataaaatatcag
tcactacaaaaacaacatgcattcactagagaacaattgcaaagaatgaagctgcaaatg
gctaccctgctacagatgaaaggttctcaggcagaattcgagcagctggaacgcttacag
tcaatgttggagcaaaagaacggtgaaatagaaaatcttcttgtgaaagtgaggcaacta
gaaaaattcaagactttatatgagaatatggaagaatgtagagctagtaccagctcaaaa
ggaggagagtctgaagatggttactatgcagacttgctgcaaatgaaactcgacaactca
aacaaggaaaccgaaaccttgaaaaatgaactatctttgcagaggatgaaagctttgtat
gagagccaaagggttctggaagttgaaagaaaactctttacaaatgagaggcatttgcaa
gcttgtcagagtgagaacatgaatttgcgagttatgctggatgaattaaaaatgaaatat
gaacctgaagagttgctcaaagtcactaaaattaaaaagagaagggagaagattccagtg
gatgctacttgtgaatatttagacagcaaaaatacctcagtggatgaggctcctcttact
catcttccaagtaaggaagaagctaagatgacttcaaataacttggagcaaattgattct
tcatccagaaaacaagcgctcgaagcatcaccgatcaatatagctcttcaatcaatggac
aaagtagttgaacctgaaagagaaagaaagagagttaaaactaaggatgacagtgttgac
acctgcgcgtcatacagcagaggtggaagtaattttttgacttcgagtgcccccaggtta
acaactgaatccagatttgaagctacagaaattgaagataagaaggaaaatgtaatcacg
accaagaagaaaacacaaaagaaaaaatacactacattgtatgtgtcttctaagccaact
cctgaaacgcagtgtgctcagcagtaa

DBGET integrated database retrieval system