KEGG   Gallus gallus (chicken): 416262
Entry
416262            CDS       T01006                                 

Gene name
FAM114A2
Definition
(RefSeq) protein FAM114A2
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: DUF719 RLL
Other DBs
NCBI-GeneID: 416262
NCBI-ProteinID: XP_414580
CGNC: 2985
Ensembl: ENSGALG00000004068
UniProt: E1BYZ4
Position
13
AA seq 499 aa
MSEEDNGENLKGETSHEDENEQKVEELGNTESNEEREPVPVTRKRPEPKAPSHSAGTETP
TAETSKVSEPPASQSGWGYWGSWGKSLLSTASATVATVGQGISNVIEKAETTLGIPSPSE
ISSETRDATRGSENPDANSADAAGDGSSFPIAGAFGVLSTISTAVQSTGKSVITGGLDAL
EFIGKKTMDVIAEGDPGFKKTKGLMNRTSTLSQVLREAKEKEEQQTATEVTMTTEKKAHY
GLLFDEFQGLSHLEALEMLSRECESKVKLVLNALSGEELETVKEEMEQLNEAFSLAEFFE
EEEEEKKGDEEFTKEVTELFAELRISTKPDKLIMVRTSAHDWIAQFNSSLPKEEKESEEN
EEVEPGGGDHDVKKSVEDIHAFAIRSLAELTAYSIESFHRTAALFLHGQKQEVTATDRAK
SLSQVTIVLCKELSSFSKEFTTCLTIAGVKEKADVLNPLITGVFLEASNSASYIQDAFQL
LLPVLQLSLIEARTELSQQ
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgtctgaagaagacaacggtgaaaatctgaaaggggaaacctctcatgaagatgagaat
gagcagaaggtggaagaacttggcaacactgagagcaatgaagagagagagcctgtgcct
gtgactcggaagagacctgaacccaaagcccccagtcattctgctggcacagaaacaccc
acagctgaaacttccaaggtttcagaacctcctgcatctcagtcaggatgggggtactgg
gggagctgggggaaatcccttctgtcaactgcatctgctactgtagctactgtaggtcaa
ggtatttcaaatgtcatagaaaaagcagaaacaacccttgggatccccagtcctagtgag
atctcttcagagaccagagatgctacgagaggaagtgagaatcccgatgctaacagcgca
gatgcagctggcgatggcagttcctttcctattgctggagcttttggagttctttcaacc
atctctactgctgttcaaagcacaggaaaaagtgttattaccggaggtctagatgccttg
gaattcattgggaaaaagacaatggatgtgatagctgagggagaccctgggttcaaaaaa
acaaagggcctaatgaacagaacctctacgttatctcaggtcttacgagaggcaaaggag
aaagaagagcagcagacagctactgaggttaccatgactacagagaagaaagcccattat
gggttactgtttgatgagtttcagggtctttcacatctggaggccttagagatgctttct
agagagtgtgaatcaaaggtgaaattggttctaaatgccctctctggagaagagttggag
acagtgaaagaggaaatggagcaactcaatgaagcattttctttagctgaattctttgaa
gaagaagaggaagaaaagaaaggagatgaggagttcaccaaagaagtaacagagctgttt
gcagagttgcgtatctccacaaagccggataaactgatcatggtgaggacatctgctcat
gattggatagcacagttcaacagcagtcttcctaaagaagaaaaagagagtgaagaaaac
gaggaagtagaacctggaggtggtgaccatgatgttaaaaaatcagtagaggatattcat
gcatttgccataagaagtctggctgagctgacagcatactccattgaatcgttccacaga
actgcagctttgtttctgcatggtcagaaacaggaggtgactgccacagacagagccaag
tccctttcacaagtgacgatcgtgctgtgtaaggaactgtcatctttctccaaagagttt
actacgtgcttaacaattgcaggggtcaaagagaaggcagatgtgcttaatcccttaatc
actggagtgtttttggaggcttcaaacagtgcttcgtacatccaggatgccttccagctc
ttgctgcctgtactgcagctctctcttattgaggctagaacggaactatcacagcaataa

DBGET integrated database retrieval system