KEGG   Gallus gallus (chicken): 416329
Entry
416329            CDS       T01006                                 

Gene name
RAD50
Definition
(RefSeq) DNA repair protein RAD50 isoform X1
  KO
K10866  DNA repair protein RAD50 [EC:3.6.-.-]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03440  Homologous recombination
gga03450  Non-homologous end-joining
gga04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    416329 (RAD50)
   03450 Non-homologous end-joining
    416329 (RAD50)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    416329 (RAD50)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gga03032]
    416329 (RAD50)
   03400 DNA repair and recombination proteins [BR:gga03400]
    416329 (RAD50)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-  Acting on acid anhydrides
    3.6.-.-  
     416329 (RAD50)
DNA replication proteins [BR:gga03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     416329 (RAD50)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     416329 (RAD50)
    BRCA1-C complex
     416329 (RAD50)
   NHEJ (non-homologous end-joining)
    MRX complex
     416329 (RAD50)
SSDB
Motif
Pfam: AAA_23 Rad50_zn_hook AAA_21 SMC_N SbcCD_C AAA_15 DUF2703 AAA_29 AAA_16
Other DBs
NCBI-GeneID: 416329
NCBI-ProteinID: XP_004945072
CGNC: 5128
Ensembl: ENSGALG00000006794
UniProt: F1NEG1
Position
13
AA seq 1313 aa
MAKIEKMSILGVRSFGVEDKDKQIITFFNPLTILVGPNGAGKTTIIECLKYISTGDFPPG
TKGNSFVHDPKVANETDVRAQIRLQFRDVSGELIAVQRSMVCTQKSKKTEFKTLEGVITR
TNRHGEKVSLSSKCAEIDREMISALGVSKSVLNNVIFCHQEESNWPLSEGKALKQKFDEI
FSATRYIKALETLRQVRLKQGTKVKECQTELKYLKQNKEKAQEIQDNLANREAQLSASKE
NIKSIESQLDPLKSSLAAVEKNLMEVMSLDNNVKALESRRIQMEKDNQDLQRKMEKVFQG
TDEQLKDRYHNHQRTVKEKEKRLSDCKRELDRASKECQRFNSEKSELLIERGRLQLQADR
HQEHIKVRDSLIQALSAQLELDGFEQAPFNDRQIAVFHELLKERQKSDTEAANQLMREFT
QKEAMKQEQIDKIRDRKTGLERSIDLKSDIQNKRLAELKNVKYELCQLEGSSDRIAELDR
EIVKMEHELEKAERNSNVETLEQEVQTLQNEKINLDKVLRRLDQEMEQLNLHTTTITQME
MLKKDKADKEEQIRKVKLRHSEELTLLLGYFPNKKQLEDWLHGKSTEINETRSRHALLNK
QLASAEQQKNYISAELRKKEEQLSNYEAKLFDVCGSQDFDSNLNKLQDEIEKSSKQRAVL
AGATAVYSQFITQLTEENQSCCPVCQRVFQTEAELQDVISDLQSKLRLAPDKLKSTESEL
KKREKKRDEMIGLKPIRQTVVELQERDIPDLRNRLQTVNRDFARLKGEIEEQETLLQTVL
SEKEGANACLQDITLMERYQTDIRDVERKIAQQEAKLLGVDLNRTVLQVSQEKQAKKHLW
DTVTSKIELNQKMKQDQQNQIQELKSTVNELRAEKLQISSSVQRRQQLEEQTVELTTEVQ
SLSREIKEEKEQVFPLDATLEKLQQDKEDLINKRTASNKEIQEKMNAIKEKVKDINKYTK
EIENYIQQGKEEYKKQKECELDEVNSQLVACEKQKEKISKEMEIIRQDIDTQKIQERWLE
DNLTLRERNKELKGVEDNIKELVKKMGEMKVPQLKNEQKHLEEKIEALKRNHHVALGRQR
GFEEEIVRFKKELRESQFKDAEEKHREMMIVMRTTELVNKDLDIYYKALDKAIMTFHSMK
MQEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRSYNYRVVMIKGDTALDMRG
RCSAGQKVLASLIIRLALAETFCLNCGILALDEPTTNLDRENIESLAHALVEIIKSRSRQ
RNFQLLVITHDEDFVELLGRSEYVETFYRIRKNIDQCSEIMKCSVSSLGSYVH
NT seq 3942 nt   +upstreamnt  +downstreamnt
atggccaagattgagaaaatgagcatcctgggagtgaggagtttcggtgtggaggacaaa
gacaaacagattatcaccttctttaatcccctgaccattctggtgggacccaacggcgca
gggaaaacgaccatcattgagtgccttaaatacatctccactggagatttccctcctggc
accaaaggaaactcgtttgttcatgacccaaaggttgctaatgaaacagatgtgagagct
cagattcgattacagtttcgagatgttagtggagagctcatagctgtgcaacgatccatg
gtttgtacccagaaaagcaagaaaacagaatttaaaacgcttgaaggggtcattaccaga
acaaacaggcatggtgagaaggtcagtctcagttccaagtgtgcagaaattgatcgagag
atgatcagtgcccttggtgtttccaagtcagtgcttaacaatgtcattttctgccatcaa
gaggaatccaactggccgttaagcgaagggaaggccctgaaacaaaaatttgatgagatc
ttctcagcaacaaggtatattaaagcactggaaactctccgtcaagtacggctgaaacaa
ggcacgaaagtgaaagagtgtcagacagaactgaaatacctgaaacagaataaagaaaaa
gcccaggaaatccaggacaatcttgccaacagagaagctcaactgtctgcttctaaggag
aatataaaatctatcgagagtcagctcgaccccttaaagagttctctggcagcagttgag
aagaatctcatggaagttatgtcgctggacaataacgtgaaagccctggagagcaggagg
atacagatggagaaggataatcaagatctgcaacggaaaatggaaaaggtttttcaagga
acagatgagcagctcaaggatagataccacaaccaccagagaacagtgaaggaaaaggag
aagaggttgtcagactgtaagcgggaattagatagagcctctaaagaatgccagaggttt
aacagtgagaagtcagaactacttattgaacgaggtcgtctacagctgcaagcagatcgt
caccaagagcacatcaaagtgagggattccttaatccaggctttgtcagcacagctggaa
ttggatggctttgagcaagcaccttttaatgacagacagattgctgtttttcacgagtta
ttgaaagagaggcagaagagtgacacagaagctgcaaatcagttaatgagagagttcacg
cagaaagaagcaatgaagcaagaacagatcgataaaataagagataggaaaactggatta
gagagaagcattgacctgaaatcagacattcaaaataagaggctggctgaactgaagaac
gtgaaatatgaactgtgtcagttggagggctcttcagacagaatagcagagttggatcgg
gagatcgtaaagatggagcatgaactggagaaagctgagagaaacagcaacgtggaaact
ctggaacaggaagtgcaaacgctgcagaacgagaagatcaacctggacaaagttcttcgg
aggttggatcaggagatggagcagctgaatctacataccacaactattacccagatggag
atgctgaagaaagacaaagcagacaaagaggagcagattagaaaagtaaaattgagacat
tctgaagagctgacactactgctgggatattttcctaacaaaaaacaacttgaagactgg
cttcatggcaaaagcactgagattaacgagacaaggagtagacatgccctgctaaacaaa
cagctggcatcagcagaacaacagaaaaattatatcagtgctgaactaagaaaaaaagaa
gaacagttgtccaactatgaagcaaagctttttgatgtttgtggaagccaagattttgac
agtaacctgaacaaactgcaagatgagattgaaaagagttcaaagcagcgagctgtgctt
gctggagccactgcagtttattcacagttcattacacagctgacagaggagaaccagtca
tgttgtccagtttgccaaagagtttttcaaacagaggctgaactgcaagatgtgatcagt
gatctgcagtcaaagctgcgtctcgccccagacaaactgaagtcaacagagtctgaactt
aaaaaaagagagaaaaaacgtgatgagatgataggtcttaaaccaattaggcaaactgta
gtggagctccaagaaagggacataccggacttgaggaacaggctgcagactgtgaacagg
gattttgcacgcctgaagggtgagatagaagaacaggaaacacttttgcaaacagttcta
tctgaaaaggaaggtgctaatgcatgtttacaggacataactctcatggaaaggtaccag
actgatattagggatgttgaaagaaaaattgctcagcaggaggctaagttgctaggggtc
gatttaaatagaactgttctacaagtaagccaagagaaacaagcgaaaaaacatctgtgg
gataccgttactagtaaaattgagctaaatcagaaaatgaagcaagaccagcaaaatcaa
attcaggagctgaagagtacagtgaatgaactcagagcagagaaacttcagatttccagc
agcgtgcagcgtcgtcagcaactggaggaacaaacagtggaattaaccactgaggttcag
tccttgtccagggagatcaaggaagaaaaagaacaggtatttcctctggatgcaacttta
gaaaaactgcagcaagacaaggaggatctaattaataaaaggactgcaagtaataaagaa
atacaagagaagatgaatgccataaaagagaaagttaaagatataaataagtacacgaaa
gaaattgaaaactatattcaacaaggaaaggaagaatataagaagcaaaaggagtgtgaa
cttgatgaagtaaattcccagttagttgcctgcgagaaacagaaggaaaagatcagtaaa
gagatggaaattattcgacaggatattgacactcaaaaaatccaggagagatggctggag
gataatcttactttgagggagcggaataaagagctaaaaggagtcgaagacaatataaaa
gaacttgtaaagaagatgggagaaatgaaagtcccacagctgaaaaatgaacaaaaacat
ttagaggagaaaatagaagctctgaaaagaaaccatcacgttgcactgggccgacagcgt
ggatttgaggaagagatagttcggtttaaaaaggagcttcgagagtcacagttcaaggat
gcagaggaaaagcacagggagatgatgattgtcatgagaacaacagagctggtgaacaaa
gatttggacatttattacaaggccctggataaagcaataatgacatttcatagcatgaag
atgcaagaaattaacaaaataatccgcgacctttggcgaagtacctacagaggacaagat
attgaatatatagaaattcgttctgatgcagacgaaaacgtttcagcatctgataaaaga
agaagttacaattacagagtagtgatgataaagggagatacggcgctggatatgcgagga
agatgcagtgctgggcaaaaggtacttgcttctcttatcatccgtctcgctctggcagaa
acattctgcctcaattgtggcatattggcactggatgagcctaccaccaatcttgatcga
gaaaatatagagtctcttgcacatgcccttgtggagataataaagagccgctcacgacag
cgaaactttcagctcctggtgataactcatgatgaagactttgtggaactccttggtcgt
tctgagtacgtggaaaccttctacaggatcaggaagaacattgatcagtgctccgagatc
atgaagtgcagcgtcagctcccttggctcatacgttcattaa

DBGET integrated database retrieval system