KEGG   Gallus gallus (chicken): 416386
Entry
416386            CDS       T01006                                 
Symbol
ABCA3
Name
(RefSeq) ATP-binding cassette sub-family A member 3 isoform X2
  KO
K05643  ATP-binding cassette, subfamily A (ABC1), member 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    416386 (ABCA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    416386 (ABCA3)
Transporters [BR:gga02000]
 ABC transporters, eukaryotic type
  ABCA (ABC1) subfamily
   ABCA1, 2, 3, 4, 7, 12, 13 subgroups
    416386 (ABCA3)
SSDB
Motif
Pfam: ABC2_membrane_3 ABC_tran AAA_21 AAA_23 RsgA_GTPase DUF4162 AAA_30 AAA_29 SRP54 AAA_15
Other DBs
NCBI-GeneID: 416386
NCBI-ProteinID: XP_004945491
CGNC: 1393
Ensembl: ENSGALG00000037837
UniProt: A0A1D5P0F9
Position
14:complement(13971700..14006418)
AA seq 1708 aa
MVVLRQFGLLLWKNYILQKRQILVTIIEICLPLLFAAILIALRHRVHSVSHPNATIYPSL
SVDDLPGFFYRRHPGNPWELAYVPSNSSAVQSIARAVERALPISIRAQGFASERDFEDYV
RRDNRSGSVLAAVVFKHHFSHSTDPLPLQVDYELRFKYSPRNAPRSEQTGLNPNLDRDWH
TSYLFPLFQLPGPREAKFVDGGTPGYIREGFLAVQHAVDRAIMQYHTNSSATSLLENITV
VVQRFPYPSYVNDLFVLAIQNQLPLLLMLSFTYTSLNIVRAVVHEKEKKLKEYMHMMGLS
NWLHWSAWFLMFFLFLLVSVFFVTLLFCVKVSEQGAVLTSSDPTLVFTFLAIFSISTISF
NFMVSTFFSRANVAAAAGGFLYFFSYIPYFFISPRYDLMSHSQKLASCLISNVAMAMGAQ
LIGMFEGKGTGIQWRDLMKPVSVDDNFTLAQVLGMLLLDSVLYGLVAWYVEAVFPGEYGV
PQPWYFFLTPSYWCGQPRTVIGKEKEEEEDPEKALKSQYIEEEPADLVSGIKIKHLSKVF
KVGSKTKEAVKDLTVNMYEGQITVLLGHNGAGKTTTLSMLTGLYSPTSGQAYINGYEISQ
DMVLIRRSLGLCPQHDVLFDNMTVEEHLHFYAGLKGYPASKCPEEINHILRILNLEDKRH
SLTKALSGGMKRKLSIGIALIGDSKVVMLDEPTSGMDPASRRATWDLLQQQRSNRTILLT
THFMDEADLLGDRIAIMAKGELQCCGSSLFLKRKYGAGYHMVMVKEPYCNLGEISRLICQ
YVPNATMESNAGAELSFILPKESTHRFEALFTELELKREELGIASYGASVTTMEEVFLRV
GKLVDSSMDIQAIQLPALQYQHERRSNDWAMDDSSSLSGMTDMTDDSGALITEDCSSIKL
NTGFYLCCQQFYAMFMKRAMYSWRNWKMVAAQFLVPLIFTAFALIVAKTFPGPRDSSMLR
LTLEPYGQTIVPFSVPTASGLPQRLAEQYVELLDAQHQSPLEVPGGLEEYLISRASEEGG
AFNEHYIAAASFEGAGNHTVVTALFNNQAYHSPATALMLADNAVFRVLMGPNASITVTNY
PQPRNITEKAKDQLMEGQTGFAIAINLLYGMASLASTFALLLVSERAIKAKHVQFVSGVY
VVNFWLSALLWDIINFLIPCALMLVIFQAFDVQAFTQDSHLVDVMLIFLLYGWAIIPLMY
LLSFFFSVAATAYTRLTIFNILSGTATFLAVTIMSIPELGLVDLSRTLDKIFLTLPNYCL
GQCISDFYQNYEFIQFCTSSVEAIFICKAFNISYQVNYFSWESPGIGQYLTSLTVQGFSF
LFLLFLIETNLLWRLKTLVCGICRRRKWVALLNSVSVLPEDRDVADERKKVLESPPELLS
SLSSPLVIKELTKVYDSRESLLAVDRISLAVSKGECFGLLGFNGAGKTTTFKMLTGDESI
TSGDAFVDGHSILANIKKVQQRIGYCPQFDALLDHMTGRETLSMYARLRGIPERYIGSCV
ENMLRGLLLEPHADKLVRTYSGGNKRKLSAGIALIGGPPVIFLDEPSTGMDPVARRLLWD
AVTRTRECGKSIIFTSHSMEECEALCTRLAIMVNGQFKCLGSPQHLKSKFGSGYTLLAKT
RTDEEGELQAFKAFVEKTFPGSVLKHEHQGMVHYHLTNKNLSWAQVFGALEKAKEKYRLE
DYSVSQISLEQVFMSFTRFQHYTEDRGK
NT seq 5127 nt   +upstreamnt  +downstreamnt
atggttgttctcaggcagtttgggctgcttctctggaagaactacatcctgcagaaacgt
cagattttggtcaccatcatagaaatctgcctgccactgctgtttgctgccatcctgatt
gcactgcggcaccgggtacactccgtcagccaccccaatgccaccatctacccatccctg
tccgtggatgacctgccaggcttcttctaccgccggcaccccggcaacccctgggagctg
gcgtacgtcccgtccaacagcagcgccgtgcagagcatcgccagagcagtggagagagct
ctgcccatcagcatccgagcccagggcttcgcctcggagcgggatttcgaggactacgtc
cgacgggacaaccgctcaggcagcgtgctggctgctgtcgtcttcaaacaccacttcagc
cacagcacagacccgctgcccctccaggtggactatgagctgcgcttcaagtacagcccc
aggaacgcgccacggagtgagcagacggggctgaaccccaacctggaccgggactggcac
accagctacctcttcccactcttccagctgcccgggccccgcgaggccaagtttgtggat
ggaggaacgccgggttacatccgggagggcttcctggcagtgcagcatgctgtggaccgg
gccatcatgcagtatcacaccaacagctctgccaccagcctgctggagaacatcaccgtg
gtggtgcagcgcttcccctacccgtcctacgtcaacgacctctttgtcctcgccatccag
aaccagctcccactgctgctcatgctcagcttcacctacacctcgctcaacatcgtccgc
gccgtcgtgcacgagaaggagaagaagctgaaggagtacatgcacatgatgggcctcagc
aactggctgcactggagcgcctggttcctcatgttcttcctcttcctgctggtgtctgtg
ttctttgtcaccctgctcttctgtgtcaaggtgagtgaacaaggagctgtgctcaccagc
agtgaccccacgctggtgttcaccttcctcgccatcttctccatctccaccatctccttc
aacttcatggtgagcaccttcttctccagagcaaacgttgcagctgctgctggaggcttc
ctgtacttcttctcctacattccctacttcttcatctcgcctcgctacgacctgatgtcc
cacagccagaagctggcatcctgcctcatctccaacgtggccatggccatgggagcacag
ctcataggcatgtttgaaggaaaagggactggcattcaatggagggacctcatgaaacct
gtcagtgtggacgacaacttcaccttggcacaagtcctggggatgctgctcctggactcg
gtgctctatggcctggtggcctggtacgtggaggctgtcttcccaggagagtacggcgtg
ccgcagccctggtacttcttcctgacgccctcgtactggtgtgggcaacccaggactgtc
attgggaaagagaaggaggaggaggaagaccccgagaaagccctgaagagccaatacatc
gaggaggagcctgctgacctcgtgtcggggatcaaaatcaagcacctttccaaggtcttc
aaagtgggaagcaagactaaagaggcagtgaaggacttgacggttaacatgtacgaaggg
cagatcaccgtcctgctgggacacaacggtgctgggaagaccaccactctgtccatgctc
acaggtctgtactccccaacgagtgggcaggcgtacatcaatggctacgagatctctcag
gacatggttctgatccgccggagcctggggctgtgtccgcagcacgacgtgctctttgac
aacatgacggtggaggagcacctccacttctatgcagggctgaagggatacccagcctcc
aagtgtcctgaggagatcaaccatatcctgcggatcctcaacctggaggacaagcggcac
tctctgaccaaggcgctctctggtggcatgaagcgcaagctgtccattggcatcgccctc
atcggggactccaaggtggtgatgctggatgagccaacgtcggggatggatccagcttct
cgcagggccacgtgggacctcctccagcagcagaggagcaaccgtaccatcctgctgacc
acgcacttcatggacgaggctgacttgctgggggaccgcatagctatcatggccaagggc
gagctgcagtgctgcggctcctccctcttcctcaaacgtaaatatggggcggggtaccac
atggtgatggtgaaggagccgtactgtaacctgggggagatctcccgcctcatctgtcag
tacgtgcccaacgccaccatggagagcaatgccggggcagagctgtccttcatcctgccc
aaagagagcactcacaggtttgaggccctattcacagagctggagctgaagcgggaggag
ctgggcatcgccagctatggggcctcagtcaccaccatggaggaagtcttcctgagggtt
gggaagctggtggactccagcatggacatccaggccatccagctgcctgctctgcagtac
cagcacgaacggcgctccaacgactgggccatggacgactccagcagcctgagtgggatg
acagacatgacagatgacagcggggcactcattacagaggactgctccagcatcaagctc
aacaccgggttctacctgtgctgccagcagttctacgccatgttcatgaagcgagccatg
tacagctggcgcaactggaagatggtggcagcgcagttcctcgtgcctctgatcttcacc
gcctttgccctcatcgtggccaagaccttcccggggcccagggactcctccatgctgagg
ctgacgctggagccctacggccagaccatcgtgcctttctctgtccccaccgcctcaggg
ctgccgcagaggctggcagagcagtacgtggagctgctggatgcgcagcaccagtcacca
ctggaggtgccaggtggtctggaggagtacctcatctcgagagcgtccgaggagggggga
gccttcaatgagcactacatcgctgccgcctccttcgaaggagctggcaaccacaccgtg
gtcactgcactgttcaacaaccaggcctaccactccccagccaccgccctcatgctggct
gacaatgctgtcttcagggtgctgatgggccccaacgcttccatcacggtcaccaactac
cctcagccacgcaacatcaccgagaaggccaaggaccagctcatggaaggccagaccggg
tttgccatcgccatcaacttgctgtatggcatggcctcgctcgccagcacctttgctctc
ctgctggtcagtgagcgggccatcaaggccaagcacgtccagttcgtcagcggtgtctac
gtggtcaacttctggctgtctgccttgctctgggacatcatcaatttcctcattccgtgt
gctctgatgctggtgatattccaagcctttgatgtgcaagccttcacccaagacagccac
cttgtcgatgtgatgttgatcttcctcctttatggctgggccatcatccccctcatgtac
ctcctcagcttcttcttttcagtggcggccacggcttacacccgtctcaccatcttcaac
atcctctctggcacagccaccttccttgctgtcaccatcatgagcatcccagaattgggc
ttggtggacctctccagaactctggataaaatctttctcaccttacccaattactgcttg
ggtcagtgcatcagtgacttctaccagaactacgagttcattcagttctgcacctcttct
gttgaagccatcttcatatgcaaggcattcaatatcagctatcaggtgaactacttttcc
tgggagtcgcctgggattgggcaatacctgacctccttgaccgtccagggtttctccttc
ctcttcctcctcttcctcattgagacgaaccttctctggagactgaaaactttggtctgt
ggcatctgcaggcggcggaaatgggtggcactgctgaacagcgtgtctgtgctgcctgag
gaccgggacgtggcagatgagaggaagaaggttttggagtcgccaccggagctgctgtca
tcactgagcagccctctggtcatcaaggagctcactaaggtctatgacagccgggaatcc
ctgctggcagtggacaggatctctttggcagtcagcaaaggggaatgctttggccttctt
ggcttcaatggagcgggcaaaaccaccacgttcaagatgctgacgggtgatgagagcatc
acgtcgggggatgcctttgtggatggccacagcattctggccaacatcaagaaggtgcag
cagcggatcggctactgcccgcagtttgatgccctgctggaccacatgacaggccgtgag
acactcagcatgtatgcccggctgcggggcatccccgagcgctacatcggcagctgcgtg
gagaacatgctgagggggctgctcctggagccccacgccgacaagcttgtcaggacctac
agtggtggtaacaagcggaagctgagcgctggcatcgccctcatcggtggcccccccgtc
atcttcctggatgagccctccactggcatggaccccgtggcccggcgtctgctctgggat
gcagtgacccgcacgcgggagtgtggcaaatccatcatcttcacctcccacagcatggag
gagtgcgaggcgctgtgcacgcggctggccatcatggtgaacgggcagttcaagtgcctg
ggcagcccccagcacctgaagagcaagtttggcagtggctacaccttgctggccaaaacg
cggactgatgaggagggcgagctgcaggccttcaaggcctttgtggagaagactttccca
ggcagtgtcctgaagcacgagcaccagggcatggtgcactaccacttgaccaacaagaac
ctcagctgggcgcaggtctttggggccttggagaaagccaaagagaagtatcgcttagaa
gactattcggttagccagatatccctggagcaagtcttcatgagcttcactcgcttccaa
cactacacagaggacagagggaaatga

DBGET integrated database retrieval system