KEGG   Gallus gallus (chicken): 416490
Entry
416490            CDS       T01006                                 

Gene name
ARPC1B
Definition
(RefSeq) actin-related protein 2/3 complex subunit 1B
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
gga04530  Tight junction
gga04810  Regulation of actin cytoskeleton
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    416490 (ARPC1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    416490 (ARPC1B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    416490 (ARPC1B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    416490 (ARPC1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    416490 (ARPC1B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    416490 (ARPC1B)
Membrane trafficking [BR:gga04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    416490 (ARPC1B)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     416490 (ARPC1B)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A
Other DBs
NCBI-GeneID: 416490
NCBI-ProteinID: NP_001025803
CGNC: 15421
Ensembl: ENSGALG00000032588
UniProt: Q5ZI99
Position
14
AA seq 369 aa
MAYHSFLLEPISCHAWNKDRTQIALCPNNHEVHIYRKDGAKWSKVHELKEHNGQVTGIDW
APESNRLVTCGTDRNAYVWTLKGNVWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLI
SICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERP
SPTPWGSKMPFGELMFESSSSCGWVHSICFSASGNRVAWVSHDSTLCLADANKKMAVASL
CTETLPLLAVTFITESSLVAAGHDCYPMLFTYEEGPGTLSFGGKLDVPKQSSQRGLTARE
RFQNLDKKASSDTANAALDTVHKNSISQISVLVGGKANCSQFCTTGMDGGMSIWDVKSLE
SALKDLRIK
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcctaccacagcttcctgctggagcccatcagctgccatgcctggaataaggaccgg
acccagatcgcgctctgccccaataaccacgaggtgcacatctaccgcaaggatggggcc
aagtggagcaaggtgcacgagctgaaggagcacaacgggcaggtgacaggcattgactgg
gctcctgagagcaaccggctggtgacgtgcgggaccgaccgcaacgcctacgtctggacc
ctgaagggcaacgtctggaaacccaccctggtcatcctgaggatcaaccgggctgcccgc
tgcgttaagtggtcccccaaggagaacaagtttgctgtgggcagcggctcccggctcatc
tccatctgctacttcgagcaggagaatgactggtgggtgtgcaagcacatcaagaagccc
atccgctccacagtgctcagcctggactggcatcccaacaatgtgctgctggccgccggc
tcctgcgacttcaagtgtcggatcttctcagcttacatcaaagaggtggaggagcggccc
agccccacgccttggggctccaagatgcccttcggggagctgatgtttgagtcaagcagc
agctgcgggtgggtgcacagcatctgcttctcagccagcggcaaccgcgtggcctgggtg
agccacgacagcaccctctgcctcgccgatgccaacaagaagatggccgttgcctccctg
tgcactgagacccttcctctcctggccgtcaccttcatcaccgagagcagcctggtggcc
gcgggccacgactgctacccgatgctgttcacctacgaggagggcccgggcaccctgagc
tttggggggaagctggatgtccccaagcagagctcccagcgtggcctcactgcccgcgag
cgcttccagaacctggataagaaggcgagctccgacacggccaacgctgcgctggacaca
gtgcacaagaacagcatcagccagatctccgtgctggtgggaggcaaagccaactgctcg
cagttctgcaccacggggatggacggtggcatgagcatctgggacgtcaagagcctggag
tcagcactgaaggatctcagaatcaaatga

DBGET integrated database retrieval system