KEGG   Gallus gallus (chicken): 416492
Entry
416492            CDS       T01006                                 

Gene name
BUD31
Definition
(RefSeq) protein BUD31 homolog
  KO
K12873  bud site selection protein 31
Organism
gga  Gallus gallus (chicken)
Pathway
gga03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    416492 (BUD31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    416492 (BUD31)
Spliceosome [BR:gga03041]
 Complex B
  Other components
   Prp19-related factors
    416492 (BUD31)
 Complex C
    416492 (BUD31)
SSDB
Motif
Pfam: G10
Other DBs
NCBI-GeneID: 416492
NCBI-ProteinID: XP_001233098
CGNC: 3487
Ensembl: ENSGALG00000004705
UniProt: E1BV47
Position
14
AA seq 144 aa
MPKVKRSRKPPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYI
FDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR
VPKSKLEVGRIIECTHCGCRGCSG
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcccaaagtgaagcggagcaggaagccgccccccgatggctgggagctgatcgagccc
acgctggatgagctggatcagaagatgagagaagcggagactgagcctcatgaagggaag
aggaaagtggaatccctttggcctatcttcagaattcaccatcaaaaaacacgttacatc
tttgatctcttctataaaagaaaagctatcagcagagagctttatgaatactgcatcaag
gaagggtacgctgacaaaaacctgattgcaaagtggaagaaacagggttatgagaacctc
tgctgcctgcggtgcatccagacgcgggacaccaacttcggaaccaactgcatctgtaga
gtgcccaaaagcaaactggaagtggggagaatcattgaatgcactcactgtggatgcaga
ggctgttctgggtga

DBGET integrated database retrieval system