KEGG   Gallus gallus (chicken): 416544
Entry
416544            CDS       T01006                                 

Gene name
RPS2
Definition
(RefSeq) 40S ribosomal protein S2
  KO
K02981  small subunit ribosomal protein S2e
Organism
gga  Gallus gallus (chicken)
Pathway
gga03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    416544 (RPS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gga03011]
    416544 (RPS2)
Ribosome [BR:gga03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    416544 (RPS2)
SSDB
Motif
Pfam: Ribosomal_S5 Ribosomal_S5_C
Other DBs
NCBI-GeneID: 416544
NCBI-ProteinID: NP_001264093
CGNC: 50281
Ensembl: ENSGALG00000005490
UniProt: E1C4M0
Position
14
AA seq 286 aa
MADDAGAAGGAGAARGGFRGGFGTGLRGRGRGRGRGRGRGRGARGGKAEDKEWIPVTKLG
RLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAF
VAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGR
CGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKT
YSYLTPDLWKETVFTKSPYQEFTDHLAKTHTRVSVQRTQAAAVATT
NT seq 861 nt   +upstreamnt  +downstreamnt
atggcggacgacgccggtgctgcaggaggggcgggagccgcccgagggggcttccgcggc
ggcttcgggaccgggctgcggggccgcgggcgcggccgtggtcggggccgagggagaggc
cgcggggcgcgtggtggcaaggcggaggataaagaatggattcctgtcaccaaacttggt
cgcctggtcaaggatatgaagatcaagtctctggaggagatctacctcttctcccttccc
atcaaggagtcagagatcatcgacttcttcctggggtcttctctgaaagatgaggtgttg
aagatcatgcctgtccagaagcagactcgtgctggtcagcgtaccaggtttaaggctttt
gttgccattggagactacaatggccacgttggtctcggtgttaaatgctctaaagaagtt
gctactgctattcgtggggcaatcattttggctaaattatccattgtaccagtgcgacga
ggctactgggggaacaagatcggcaagcctcacactgtgccttgcaaggttactgggagg
tgtggatctgtcctggtgcgtctgatcccagcgcctcgtggtacaggcatcgtgtctgcc
cctgttcctaagaagctgctgatgatggctggaatcgatgactgttatacctcagccagg
ggctgtactgccacacttggcaactttgctaaggccaccttcgatgccatctccaagaca
tacagttacctgactcccgacctctggaaagagactgtattcaccaagtctccttaccag
gagttcactgatcatctggctaagacccacaccagagtctcagtgcagagaacccaggca
gctgctgtggcaactacttaa

DBGET integrated database retrieval system