KEGG   Gallus gallus (chicken): 416553
Entry
416553            CDS       T01006                                 

Gene name
PKD1
Definition
(RefSeq) polycystin-1 isoform X1
  KO
K04985  polycystin 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    416553 (PKD1)
   04040 Ion channels [BR:gga04040]
    416553 (PKD1)
   04091 Lectins [BR:gga04091]
    416553 (PKD1)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    416553 (PKD1)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   416553 (PKD1)
Lectins [BR:gga04091]
 C-Type lectins
  Group 10: Polycystin
   416553 (PKD1)
SSDB
Motif
Pfam: PKD REJ PKD_channel PKD_4 PLAT LRR_8 Lectin_C Y_Y_Y WSC LRR_4 LRR_5
Other DBs
NCBI-GeneID: 416553
NCBI-ProteinID: XP_015149930
CGNC: 50282
Ensembl: ENSGALG00000005714
Position
14
AA seq 4383 aa
MPFGNGDTGTQRKHGVPAARLPLSGWCLLCSLLCGGLAAARTPPAPSCQPCAADCTCAGG
RPGAACIANCSARGLERPPGVPTAATALDLSRNKISALDVQMFRSLTSLAKLDISHNKIS
TLEEGIFDNLFNLSEINLSWNPFFCDCKLSWLPRWVEDRKVTVLQAADTRCAHPPGVANL
SLFSVSFVNATCGAQYVTCLTSNHTDEAELVILFTSSHPGNLTEETCSALCYADDQEYGG
FSPQGQCLCGTAHEPNSSSSCLLFCTEHSSGQACGGPSLIHFPFQAQLSVSFIGLKPRYS
LHEAVLFNVSIPIAVSTLIWEFGDQTEVLNTTGNAAVHTYALPGQYNVTATLFVGTKVSY
VQAEIEVVASPQQLELQCPSLIKTNESLDIRIRNRGGTGLTVLYGITAESGEPGRAVHPM
CPHDGLVFPGNNHCYQLVVEKAEWLEAQQHCQEHGNGELAFVSSPEIQSFLVTHVIRSLD
VWIGFNDFASSEAQQRGEGFNIESCQNWLPGEPHPSNADHCVRMGPTGQCNTDLCMAKHS
YVCEFKPKGVLLNAENFFVGDPVFDTHVAAKNVIEDTLSSPLQAVEVMVFPELAFRHEGY
LSALEFVTQELHQPIQMRFQVHRPIDGKEYQEGQNATEPFPTSQDDGNYTLVECPPGFQW
CHLTNLCSSVNNCCNAMECTNSSFASSPIPASPQHKGSQLSYELVKEFLFTIPAGPSAPY
LVTFSKEDVFVRAKDVLSIQHNAGMGSFLQCQPSTTSPFRTNYFSTNSSDWALGLPASSI
GATWIHNTVCSLRVLYAKEQLVPIISPQNAGLAHPGLYTVRASVDNGIFSANLSCNFWVT
SQVSGLRVVHPAPQGGKVYVPSDHITLVVKISSGMNATARWLGDNHTFPFEEACPLTIAP
LTSDCARENNDTWFAVLSLSGLKEGASTHTLVAENAISSQNITITIKVEQPIRGLRATPD
PESRVLLNTRVSYVPVMEAGSDVTFRWTVDDKPSFTFYNVVFNVIYQSPAVYKLSLTASN
HVSNFTVNYNVTVEMMNKMKNLTVLGIPPVLPQNSTVEFTARVQVDSAVDAMFLWDFGDG
IQETYQFTPPYNKSFLVPDPSVHEVIIEHNVSHVYEYPGDYILVVQVSNQFENLTCLTPV
RVHSYLVDVQIETVKDVLVVNRSVTFRAIPLPSPYGVLYTWDFGDGSSLVTESQSTVTYS
YSSRGVYNISVSANNTINSVETVECYQVFEEITGLHVAADEVAEVGATVTLNASVQTGDS
ITWIFDMGDGTVLRSQVPVVEHVYTKDINCTVNVTAVNPVNSVSQTIPVWIFVLEVLRID
PTSCILEHPDVQLTAYVTGNPDEYIFDWTFGDGSSNVTVSGDPVVMHNFTRSGTFPLSLT
LSSRFNKAHYFTSVCVEPEIVNVTLLPSKQFVRLGEECSFQVSAVPLYQYRYRWDFGNNE
STRSSGTEVSYNYKSTGVFLVTVTVSNNVSFNNDTAFVEVQEPVGVAKIEYNGTKVLELN
QIYLFSASMNGTKVNYFWDFGDGITQPGQITTHSYNNTGHYTISVTGQNDVSTNETRVDV
TVKRRLHGITINASRTIVPLNGSVSFVATLVAGSAIRYSWILCDRCTPIQGSSTISYTFR
SVGTFNVIVTAENEISSLQDSIYVYVLEQIEGLQVASSDLVEDLYFPTNKTLHLHAVVRE
GTNISYSWIAQKDGNAVQTATGKTFSLNVLEAGNYTVYLKATNMLGSTTANKTLEFIESL
GLLKPYAFPNPVAVNASVNISATITSGTGIVYVWYLEDGLSPVTSESFIIHSFQSPGAME
VVIGAENKLDSTNATISVYVEEVIEELSIGTAELDCRYVSSGSTVVFEGELQKGTEVTWL
WEVPNGTLTGQSVAVMFPTAGFYTVYLNASNDISWAVASRNISVLDRIQGLEVIASKKVV
EPGEQVTFVIRMSSGTSVSYLVSISGDYSVVLNGSKYTHEFTKSGDYLVTVTVQNQISIA
HAQVLISVLEAVRDIRLLNCCERGIPTGTEKSFSAQVGSGSRVLFSWQFSLWKERGRSVV
TAAGESVSYTPEAAGLLEIHLRAFNDLGGINITRTIQVQDPILQVSLTASNAFVNRTALF
EAAVIPNGRGVEFLWTFGDGSSTQMTRVAVANYSYLSPGDYLVEVNATNLISFFVAHLTV
TVKVLECEEPEVELALPPQVVMKRSQRNYLEAQLDLRGCIKYQTEHLWEIYRAPSCLHLD
DSSRIHLPNVDVNRPQLVIPKLALEVGNYCFVFIVSFGDTPLSKSIFANVTMIPSKLVPI
IDGGSYRVWSNTQDLILDGEKSYDPNLDDGEQTPLFYQWSCTFSSKQSSAAGCSLNFSAN
GGNVTIPKAVLEADVEYTFNLTVWKKGMNPEATNQTVFIKRGGVPIVSLECVSCKAQSVY
EVSKSSYVYLEGTCQNCHNDSKIGRWAAHSFKNKSLILDKKTTSTGDTGMNLVLRQGALK
DGEGYTFTLHITDLTTGEEGFASIDLLPNQPPIDGSCQLSPKGPLRALMAKVHFECTGWR
DTESAEDPLVYILLASRHRAGHYHEFCVYKGSRAEHSAFLPPGFHESGFVVSVSVLVQDQ
LGATVVAINQSMEIGLPEGFPSLSYWLYNQTDTVLQGLVKQGDPQQVIEYSLALITILNE
YERSMLLEPETGNEFELRTWTRNNITETLNSLNVNTVDDIQQISAALAQCTVVSKELVCK
SCLTRTLNKLESMMTILQGEMTQGTVTPTGIADNILNITGDLIHLVNTVSQESKPQELLA
DSHNLLLAPKAYNLSSSLMRILMKSRVLNEEPLELVGGEIKATGKRSDPFNLLCYENTPN
CQFSIPQAFNTTLSNLTDVIQVMFQVDSNPFPFGYINNYTVSTKVASMEFQTYNGVQIPI
GSLDSERAITVMVSNNTDADNLSAGTEVIEARTSVNLIVTMENNNREAGLHFRLTYKVLN
DRYVASEPEPFIMAYLHHEPEPNEHNCTASKKISLEALSGSDHKLYTFFTSPLTDDTIQK
YYLNITNHFSWSPVEVTLGLYTSLCQYFSEQEKRWKTEGIIPLEETRPDQAVCLTQHLTA
FGASLFVPPNSVQFIFPAPGSGLNYIVLLTCAVCFVTYSVAALIVHKLDMIDINRVGVIP
FCGKNGLYKYEILVKTGWGRGSGTTAHVGIALYGVDNKSGHRHLDGENAFHRNSLDVFQI
ATERNLGSIWRIRIWHDNKGLSPSWYLQHVIVRDLQSSKSYFFLVNDWLSVESEENDGMV
EKEVYAASETELRSFSRIFIAELQRGFFEKHVWLSMWDRPPRSRFTRVQRATCCSLLIFL
FLCANAVWYGVVGNVHLSSGAVSNLIPVNVDTVAVGLVSSVVVYPLYLVILFLFRMARAK
VSINHTVTHSDQQSLEIDNYLDSSVLDSSFPTFPGLRAEAFSEQTKTDLFLEDSKSLIRW
PSSEALLSWPDLLSDPSIMGNTIQKLKRGRASRHLGLEAPLATEEDNLSLGVHQGQPRYF
SASDEDLIRQILADGASGISHSQDLGPYMRAETDLISGLSSVFGEKVETVMMQKLNDKGQ
SMAAPPREVSRSAKSTWTVADQTFRKRLLPSWCSYLAHGISFFLFATSTGVSVWIGVGFS
SSVALMWLISGIFSFLASFLVWEPLKVLLEALYFSLVAKRLHPEEDDTLVEHPFVEHVSE
KISKVRPPQGFALFQAKEEARKVKLLHRMLKNFLIYMMFLLVILLTNYGDATRNSRAFLL
QSSIKQQLGSSEFLHIKRSDQFWVWMSQVFLPYLYNNQSGQESYSTTLGVARLRQLRLQE
AECQLTAQDVLHGLGTVARKNCIDSHSFSTADYAAGWERAAVNVTTAWSYSPPDLTGVWY
WGYISFYDSGGYIQELGTSLEEGRAQLNYLQQHTWIDNMSRVVFVELMQYNPSVDLHAAI
TLQLEFLGAGQAVTTVTISPFPLLRLSSGVTLQLLMMVFLMMFVVYFVVSESLSIKKEGR
AYFTLWGNYGQWVFILLTTCTVVVHLSQATLADQQWLKYLNNRKVFTNFYQVAFLNTVFS
TLAASLLFLLIVQAAQQLRFVRQWSVFGKTFQKSMKELTAAGLAFVVLILAYAQLGFLLF
SSSSESFRSVGSSLLLLIAMVRGGVSLYPCPPDSSGLYYLFCTSYIILEVWIVLRLFTVV
LVYSYREMHFEMYRPAFEPQDYEMVELFVRRLKMWMGFSKAKEFRHKVRFEGMEPLPSRD
SSDSKSIRGPTPSAASDSSRASTSSSQLDGLSLVLSTRDSLEVDADLQRLLSLFEMLLAQ
FDRVNQVTEDVYRIEHQLQGSQSRRSRRRHSLVPEDVLSRYCAGNTERGPSPETSSPMDP
QLPLSPHSPGSRSSVPSHLIRASRGISGAASVLPPHKAHSTLAPAVKKKRPLRAKNRVHP
TVK
NT seq 13152 nt   +upstreamnt  +downstreamnt
atgccttttggaaatggagacactggaacacagcgcaaacatggcgtccccgcggcgcgg
ctgcccctctcgggctggtgcctgctctgctccctgctgtgcggggggctggcggccgcc
aggacccccccggccccctcctgccagccctgcgccgccgactgtacctgcgccgggggc
cggcccggagccgcctgcatcgccaactgctccgcgaggggcctggaacggcctccgggc
gtcccgaccgccgccacggctctggatctttccagaaacaagatcagtgctttagatgtc
cagatgttcagaagcctgacttctctggcaaaactagatataagccacaacaagatttct
acattagaagaaggaatatttgataatttatttaatttaagtgaaataaacttaagttgg
aatccatttttttgtgactgcaagctttcctggttgccccgctgggtggaagacagaaaa
gtgaccgttctccaggcagcagatacacgatgtgctcaccctcctggggtggcaaacctt
tctctcttcagtgtttcgttcgtcaatgctacttgtggagctcaatatgttacgtgcctg
acaagcaaccacacggatgaggctgaacttgtcatcctcttcacatcttctcaccctggg
aacctcactgaggagacctgcagtgccctctgttatgctgacgaccaggaatatggaggt
ttcagcccccaggggcagtgtctgtgtggtactgcccacgaaccaaactcttcttccagt
tgtttgctgttttgcactgagcattcatctgggcaggcctgcggtggcccatccctcatc
cactttccctttcaggcacagctgtctgtgtctttcataggactcaagccccggtatagc
ctacacgaggctgtgctcttcaatgtcagtattccaattgctgtcagcactttaatatgg
gaatttggggaccaaacagaggttctcaacaccactggaaatgcagctgtccacacgtat
gccttacctgggcagtacaatgtcactgccaccctctttgtgggcaccaaggtctcatat
gtgcaggcagaaattgaggtggtggcttcaccccaacagttagaactgcagtgcccttcc
ttgatcaagacaaacgagagtctggacataaggatccgcaacagaggtggcactggcctc
acagtgttatatggaatcacagcagagtctggagagcctggcagagcagttcaccctatg
tgtccccacgatggcttggtcttcccgggcaacaatcactgctatcagctggtggtggag
aaggctgagtggctggaggcccagcagcactgccaggagcatggcaatggagagctggct
tttgtgagcagccccgagatccagagcttcctggtcactcatgtcatcaggagccttgat
gtctggattggattcaatgattttgcaagctctgaagcacagcaaagaggcgaaggattt
aatatagagagctgtcagaactggcttccaggagaaccccatccatccaatgccgatcac
tgtgtccggatgggcccaacgggccagtgtaacacagacctgtgcatggccaagcacagc
tatgtgtgcgagttcaagccaaaaggagttctcttaaatgccgaaaacttctttgtggga
gaccctgtgtttgacacacatgtggctgcgaaaaacgtgatagaagatacgctgtcatct
ccactgcaagctgtggaggtgatggtgttccctgagctggcattcaggcacgagggatat
ttgtctgccctggagtttgtgacacaagagctgcatcagcccattcagatgaggtttcag
gtgcatagaccaatagatggaaaagagtaccaggagggacaaaacgctacagaaccattt
ccaacatcacaggacgatgggaactatactctagttgaatgtcctcctggcttccagtgg
tgtcatttgactaatttgtgctcatcagtaaacaactgctgcaatgcgatggagtgcacc
aacagttcttttgccagcagccctatccctgcatcccctcagcacaaaggaagccagctc
agctatgaactcgtcaaggaatttctatttacaataccagctggcccttctgccccttat
ctggtcacattcagcaaagaagatgtttttgtgagggccaaggatgtcttgagtatccag
cacaatgcaggcatgggctcattcctccagtgccaaccaagtaccacgtcccctttcaga
accaattattttagtacaaactcttcagattgggcacttggcctccctgccagctccatc
ggtgccacctggatccataacactgtttgctctctccgagttctctatgccaaggagcag
ctggtcccaataatcagcccccagaacgcagggctagcacatccgggactttacacagtc
agagccagcgtggacaatgggatcttcagtgccaatctgtcgtgcaatttctgggttact
tcccaggtgtcaggcctgcgtgttgtccacccggctcctcaaggtggcaaggtgtacgta
ccatccgaccacatcaccctggtggtcaaaatctcctcaggcatgaatgcgacggcacgc
tggctgggagacaaccacaccttccccttcgaagaggcctgcccactgactattgcaccg
ctgacatcagactgtgccagagagaacaatgacacctggtttgctgtgctcagcctgagt
ggcctcaaggagggggcaagtacccacacgcttgtcgcagagaatgccatcagctcccag
aacatcaccatcacaataaaagtggaacagcctatccgtgggctgagggccaccccagac
cctgagagcagagtcctgctaaacacacgagtgagctatgtccctgtgatggaagccggg
tcagatgtgactttccgatggacggtagatgataaaccatctttcactttttacaatgtt
gtcttcaacgttatctaccaaagcccagctgtgtacaagctttcgctcaccgcctccaac
cacgtcagtaactttacagtcaactacaatgtcacggtggagatgatgaataagatgaag
aacctgactgtgttgggcatcccgccggtcctccctcagaacagcaccgtggagtttaca
gcaagagttcaggttgattcagctgtggatgctatgttcctgtgggattttggagacggt
atccaggagacataccagttcacacctccctacaacaagtctttccttgttcctgatccc
agtgtccacgaggttataattgagcacaatgtgtcacacgtctatgaatacccaggtgat
tacatcctggtggttcaagtgtcaaaccagtttgagaacctcacctgcttgaccccagtt
cgcgtccacagttatttggttgatgtgcaaatagaaacagtgaaggatgttttagttgta
aaccgttcggtcactttcagagccattccactgccatctccctatggtgtcttgtacact
tgggacttcggggacgggtcctcactggtgacagagagccagtctacggtgacatacagc
tactccagcaggggggtatacaacatctctgtgtcagcaaacaacaccataaacagtgtg
gagacggttgagtgttaccaagtgttcgaagagataactgggctccatgttgccgcagat
gaggtggcagaggtgggtgcaactgtaacccttaatgcttcagtgcagactggagacagt
atcacctggatatttgacatgggggatgggacggtgctgaggagtcaggtgccggtggtg
gaacatgtgtacacaaaggacatcaactgcactgtgaatgtgacagctgtgaatcctgtc
aactctgtctcccaaactattcctgtttggatatttgtcctggaagtactcagaatagac
cctacttcttgcattcttgagcatccagatgtgcagctcactgcatacgtgacggggaat
cccgatgaatacatctttgattggacctttggagatggctcatccaacgtcacagtcagt
ggggaccctgtagtgatgcacaacttcacacgaagtgggacgttccccttgtccctgact
ctctcgagcaggtttaacaaggctcattatttcaccagtgtctgtgtggagccagagata
gtcaacgtcacgcttctcccttccaagcagtttgtgaggcttggtgaggagtgcagcttc
caggtcagcgctgtgcccctctaccagtaccgctaccgctgggattttggcaacaacgag
tccactaggtcgagtgggactgaagtgagctacaactacaagagcacaggggtcttcctg
gttacagtgactgtctccaacaatgtctctttcaacaatgacacggcatttgtggaagtc
caggagccagttggggtagcaaagattgaatataacgggacgaaggttttagagctgaac
cagatctacctgttctctgccagcatgaatggaaccaaagtgaattacttttgggacttt
ggagatggcattacccagcctggccaaatcactacccactcctacaacaatactggccat
tacactattagtgtgacaggccagaatgatgtgagcactaatgaaaccagggtggacgtc
acagtgaaacgtcggctacatgggattaccatcaatgccagcaggacaattgtgccttta
aatggttctgtgagttttgtggccacgcttgtagctggcagtgccatccgttactcttgg
atcctctgtgaccggtgtactcctatccaaggctcctccacaatttcctacacctttcgc
tccgtgggcacattcaatgtcattgtgactgcagagaatgagatcagctcattgcaggac
agtatctacgtctacgttttggaacagattgaaggcctgcaggtggctagcagtgacctg
gtggaggatctctatttcccaactaacaaaacactccatctgcacgcggtggtgagagag
gggacaaacatctcttacagctggatagcccagaaagatggcaatgctgtgcagacagcc
actgggaaaaccttctccttgaatgtcttagaagctggaaactacactgtctatctgaaa
gctactaacatgctgggaagcacaactgctaacaagacattggaattcattgaaagcctt
ggtcttctaaagccttatgccttccccaacccagttgctgttaatgcatctgttaacata
agcgccaccataaccagtggcactggtatcgtgtatgtttggtacctggaggatggcctc
tctcctgttacatctgaatcctttatcatacactccttccaaagccctggagctatggag
gttgtaattggagcagaaaacaagctggattcaaccaatgcaacaattagtgtctatgta
gaggaggtcatagaggaactcagtatagggactgcagaactggactgtaggtatgtctca
tcgggctccactgtggtctttgaaggagagctgcagaaggggactgaagtgacctggctt
tgggaggtaccgaatggcacactgacaggccagtccgtggcagtcatgttccccacagca
gggttttacacagtctatctaaatgcatcaaatgacatcagctgggctgtggccagcagg
aatatctctgtgcttgacaggattcaaggactggaagttattgccagtaagaaggtggta
gagccaggtgagcaggtcacctttgtgatcaggatgtcgtcgggtacctctgtgagttac
ttggtgagcataagtggggactactccgtggtgctcaatgggtccaagtacacacacgag
ttcaccaagagcggcgattatttggtgacggtgacagtgcagaaccaaatcagcattgct
catgcccaggtgctcatctcggttctggaggccgtccgtgacatcaggctcctaaactgc
tgtgaacgaggcattcccacaggtacagagaagagcttcagtgcccaggtggggagcggc
tcccgggtgttgttctcctggcagttctccctgtggaaggagcggggccgctccgtggtc
actgcagcaggagagagtgtttcctacactccagaagctgcagggctgcttgagattcac
ctcagggccttcaatgacctgggaggtatcaacatcaccagaaccatccaggtccaggac
cccatactccaagtctccctcaccgcctccaacgcctttgtcaataggacagcgctgttt
gaagcagcagtgatacccaacggcaggggcgttgagttcctgtggacctttggggacggc
tcttccactcaaatgaccagggttgcagtggccaactattcttacctgagccctggggat
tacctggtggaggtgaatgccaccaatctcatcagcttcttcgtagcccacctcactgtc
accgtcaaggtcctggagtgcgaggagccggaggtggagctagccttgccccctcaggtg
gtcatgaagcggtcccagaggaattacctagaggcacagctcgacctgcggggatgcatc
aagtatcagacggaacacctatgggagatataccgagcacccagctgtctgcacctggat
gactccagcaggatccatctgccaaatgttgatgtgaacaggccgcagctcgttatacca
aagctcgccctggaagttgggaactactgctttgtctttattgtctcctttggagatact
ccgctgtccaaaagcatctttgccaatgtgaccatgataccgagtaagctggtcccaatc
attgatggggggtcataccgtgtatggtccaacactcaagacttaatcttggatggggag
aaatcctatgacccaaacttggatgatggtgaacagactccgttgttttaccagtggtct
tgtacgttctcctccaagcagagctcggctgcagggtgctctctgaatttcagtgccaat
ggaggaaatgtcacaattcccaaagctgtattagaagcagatgtggagtatacgttcaac
ctcactgtctggaagaagggtatgaatcccgaggcaacaaatcaaaccgtatttatcaag
aggggaggagtcccgatcgtatccctggagtgtgtttcctgcaaagctcagtcagtctac
gaagtcagcaaaagctcctatgtctacctggagggaacctgccagaactgccacaatgac
tccaagattgggagatgggcagcgcacagctttaaaaacaagtctctcatcctggacaaa
aaaactacctccactggtgatacgggaatgaacctggtcttgaggcaaggggcgctgaag
gatggggagggctatacttttacccttcacatcacagacctcacaacaggggaggaaggg
tttgcctccattgacctgctccccaaccagccgcccatcgacggatcctgccagctgtct
cccaaaggaccgctcagggcactgatggcaaaggtgcactttgagtgtacaggctggagg
gacacggagagcgcagaggacccactggtgtacatcctcctggcgtctcgccaccgcgcc
gggcactaccacgagttctgtgtgtacaagggcagccgtgccgagcacagcgccttcctg
cctccgggctttcacgagagtggcttcgtggtgtctgtgtcagtcctcgttcaggaccaa
ctgggagcaaccgtggtggccattaaccaatccatggaaattggcttacctgaggggttc
cctagcctctcctactggctctacaatcaaacagacaccgtgctccagggcttagtgaaa
cagggggaccctcaacaggtcattgagtactctctggccctcatcaccatcttgaatgag
tatgagcggtcaatgcttctggaacctgagactgggaatgaatttgaactccggacttgg
actcgcaacaatatcacagaaaccttgaactcactgaatgtgaacacagttgatgatatc
cagcagatctcagcagcgctggctcagtgcacggtggtaagcaaggagctggtttgcaag
tcctgcctgacgaggaccttgaacaaactggagagcatgatgaccattctgcaaggggaa
atgacccagggcaccgtgacaccaactggcatcgccgacaacatcctcaacatcacaggc
gatttaattcaccttgtcaatactgtttcacaagaatccaagccccaggaactgcttgca
gattcccacaacttgctgttagctcccaaagcctacaacctgtcttccagcctgatgcgc
atcctcatgaagtctcgagtgctgaatgaagagccccttgagctggtgggaggagaaatt
aaggccacaggcaaaagatccgatcccttcaacttgctttgctacgaaaacacgccaaac
tgccagttctccatcccccaggctttcaacaccaccctttccaacctgacagatgtcatt
caagtcatgttccaagtggactccaatcctttcccgtttggttacatcaacaactacact
gtgtccacaaaggtggcctccatggagtttcagacatacaatggagtgcagatccccatt
ggcagcctggactcggagagagccatcactgtaatggtgtcgaataatacagacgctgac
aacctgtctgctggcactgaagtcatcgaggcaagaacgtctgtgaacctgattgtgact
atggagaacaacaaccgagaagcaggactgcacttccggctcacttacaaagtcttgaat
gatcgctacgttgcaagtgagcctgagccattcatcatggcctatctccaccatgaacca
gagcccaatgagcacaactgcactgcctcaaagaaaatcagcctggaggccctgtctgga
agtgaccacaagctctacactttcttcacctcaccactaactgatgacaccatccagaag
tattacttaaacatcacgaaccatttcagctggtccccagtggaggtgacactggggttg
tacacctccctgtgccagtacttcagtgagcaggagaaacggtggaagacagaaggcatc
atccccctggaagagaccaggccagaccaggctgtgtgcttaacccagcacctcactgcc
tttggggccagcctgtttgtcccacccaactcagtccagttcatctttcctgctccaggc
tcaggtctcaactacatcgttctgctgacgtgcgccgtctgctttgtgacctactcagtg
gctgcactgattgtacacaagctggacatgattgacattaaccgagttggggtgattccc
ttctgcgggaagaacgggctgtacaaatatgagatcctggtgaaaactggctggggcaga
ggatcaggcaccacggcacatgtggggatcgcgctgtacggcgtagacaataaaagtggt
cacagacacctggatggagaaaatgcgttccaccgcaacagcctcgatgtgtttcagatc
gcaacagagcggaatctgggcagcatctggcgcatccgcatttggcatgacaataaagga
ctcagcccttcctggtacctgcagcacgtcatcgtccgggacctgcagagcagcaagagc
tacttcttcctggtgaacgactggctgtcggtggagagcgaagagaatgatggcatggtg
gagaaggaggtttacgctgccagtgagacagagctgaggagcttctcccggatcttcata
gcggagctgcagagaggtttctttgagaagcatgtctggctgtccatgtgggaccgcccg
cctcgcagccgcttcacccgtgtccagagagccacctgctgctccctgctcatcttcctc
ttcctctgtgccaatgctgtgtggtacggcgtggtggggaacgtacacctcagcagtggg
gctgtttccaacctgatccctgttaatgtggacacggtggccgttggtttggtgtccagc
gttgtggtctaccctctctacttggtcattctatttctcttcaggatggctcgtgccaag
gtgtctatcaaccacactgtgactcactcagaccagcagtccttggagattgacaactac
ctggactcctcagtccttgacagctccttccccaccttccctgggctccgggcagaggcc
ttctctgagcaaaccaaaacagatctgtttttggaagactccaaaagcctcatacggtgg
ccctccagcgaggccctcctcagctggccagacctcctcagtgacccctccatcatgggc
aacaccattcagaagctgaagcgaggccgggccagccgtcaccttggactcgaggccccc
ctagcaactgaggaggacaacttgtcacttggtgttcatcagggacagcccagatatttc
tctgcctcagatgaggatctgataaggcagatactggcagatggagctagtggcatctca
cactcccaggacctaggaccgtacatgagggctgaaacagatctgatctcgggcctctcc
agtgtgtttggggagaaggtggagactgtcatgatgcagaagctgaatgacaaaggccag
agcatggcagcccctcccagagaagtgagcagatcggctaagtcgacatggacagtcgca
gaccaaacattcaggaagcgcttgctgccatcctggtgctcctatctggctcatggtatc
agtttcttcctctttgccacctccacgggggtctccgtgtggatcggggtgggcttttcc
tccagcgttgccctcatgtggcttatctcagggatattcagctttctggcatccttcttg
gtctgggagcccctgaaggtcctgctggaagccctctatttctcactggttgccaagcga
ttgcacccagaggaggatgataccttggtggagcatccgtttgttgagcatgtttctgag
aagatcagcaaagtccgacccccacaggggttcgcccttttccaggccaaggaggaagca
aggaaggtcaaactgctgcacaggatgctgaagaatttcctcatctacatgatgttcttg
ctggtgatcctgctcaccaactatggagatgccacccgcaacagcagggccttccttctg
cagagctccatcaagcagcagctgggtagcagtgaattcctccacatcaagagatcagat
cagttttgggtctggatgtcacaagtgttccttccttacctctacaacaaccagtcgggt
caggagagctacagcaccacgctgggggtggcccggctgcgccagctccggctgcaggaa
gctgagtgccagctcacggcccaggacgtcctccacgggctgggcacagttgccaggaag
aactgcatcgactcacacagcttctctactgctgactatgcagctggctgggaacgggca
gctgtgaacgtgacgactgcgtggtcctattcaccacctgacctcacaggggtctggtac
tggggttacatctctttctacgacagcggtggttacatccaggagctggggacttcactg
gaggaaggcagggctcagctaaactaccttcagcagcacacctggatcgacaacatgagc
cgggtggtctttgtggagctgatgcagtacaaccccagcgtggacctgcatgctgccatc
accctccagctggaattcctgggcgcaggccaggctgtcaccactgtcaccatcagcccc
ttcccactgctgcggctcagcagtggtgtcacactgcagcttctcatgatggtcttcctc
atgatgtttgtggtttactttgtggtgtctgagtcactttccatcaagaaagaaggcagg
gcctacttcaccctgtggggcaactatggccagtgggtcttcatcctcctcaccacctgc
acagtggtggtgcacctcagccaagccaccctggctgaccagcaatggctcaagtacctc
aacaaccgcaaggtcttcaccaacttctaccaggtggcctttctcaacacggtcttcagc
accttggctgcctccctcctcttcctcctgattgtgcaggctgcccagcagctgcgcttt
gtcaggcagtggtccgtgtttgggaagacctttcagaagtccatgaaggagctgactgca
gcagggctggcttttgtggtcctcatcctggcatacgcacagcttggcttcctgcttttc
tcctcctcctcggagtccttccgtagcgttggcagcagcctcctgctgctcattgctatg
gtgcggggcggtgtgagcctctacccctgcccgcccgactcctctggcctctactacctg
ttctgcaccagctatatcatcctggaggtgtggatcgtgctgaggctgttcactgtggtg
cttgtctacagctaccgggagatgcactttgagatgtaccgccccgccttcgagccccag
gactatgagatggtggagctctttgtgcggaggctgaaaatgtggatgggcttcagcaaa
gccaaggagttccgccacaaggtgaggtttgaaggcatggaaccgcttccatcccgggac
tccagcgactccaagtccatccggggccccactcccagcgctgcctctgacagctccagg
gcctccacctcctccagccagctggatgggctgagcctcgtgctgagcacccgggacagc
ttggaagtggacgccgacctccagcggctcctttccctcttcgagatgctgctagcccaa
tttgaccgggtcaaccaggtgacggaggatgtgtaccgcattgagcaccagctgcagggc
tcccagagccgccgctccaggaggaggcactctctggtgccagaggatgttttgagcagg
tactgtgcgggcaatacagagcgggggccctcacctgagacctcctcccccatggacccg
cagctcccactgtccccccactctcctggcagcaggagctctgtgcccagccacctcatc
cgtgccagcagaggcatcagtggggcagcttctgtgctccccccgcacaaagcacactcc
actctggctccggccgtgaagaagaagcggcccctccgagccaagaatagggtccacccc
accgtcaagtag

DBGET integrated database retrieval system