KEGG   Gallus gallus (chicken): 416575
Entry
416575            CDS       T01006                                 

Gene name
PLK1
Definition
(RefSeq) serine/threonine-protein kinase PLK1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04068  FoxO signaling pathway
gga04110  Cell cycle
gga04114  Oocyte meiosis
gga04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    416575 (PLK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    416575 (PLK1)
   04114 Oocyte meiosis
    416575 (PLK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    416575 (PLK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    416575 (PLK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    416575 (PLK1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     416575 (PLK1)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   416575 (PLK1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     416575 (PLK1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    416575 (PLK1)
  Sister chromatid separation proteins
   Polo kinases
    416575 (PLK1)
SSDB
Motif
Pfam: Pkinase POLO_box PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 416575
NCBI-ProteinID: NP_001025810
CGNC: 4585
Ensembl: ENSGALG00000006110
UniProt: Q5ZJ36
Position
14
AA seq 595 aa
MSAAGGKARPVAAVEPARAGGAAAAGGKEVPKVLLDPRTRRSYVRGRFLGKGGFARCYEL
TEAESREVYAGKVVPKSLLAKPHQKEKMSMEIAIHRSLAHRHVVGFQSFFEDGDFVYVVL
ELCRRRSLLELHKRRKALSEPEVRYYLRQIILGCQYLHSQRVIHRDLKLGNLFLSDDMEV
KIGDFGLATKVEYDGEPKKTLCGTPNYIAPEVLGKKGHSFEVDIWSIGCIMYTLLVGKPP
FETSCLKETYIRIKKNEYTIPKHINPVAANLIQKMLRSDPATRPAINELLNDEFFTSGYI
PSRLPTSCLTVAPRFSIAPSTLELNGRKPLTALNKGPESPALENLPEKEDAAGLREVGDT
IECHLADMLQQLTAVNSAKPSERTAVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCD
NSVGVLFNDSTRLIMYNDGDSLQYIEQNNTESYFTVRSCPSALNKKITLLKYFRNYMSEH
LLKAGANITPREGDELARLPYLCTWFRTRSAIILHLSNGTVQINFFQDHTKVILCPLMAA
VTYIDEKRDFRTYKLSLIEEHGCCKELASRLRYARTMVEKLLSSKSGSARVKSST
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgagcgcggcgggcggcaaagcccggccggtggcggcggtggagccggcacgagcgggc
ggcgcggcggcggcggggggcaaggaggtgccgaaggtgctgttggacccgcggacgcgg
cgcagttacgtgcggggccgcttcctgggcaagggcggcttcgcgcggtgctacgagctg
accgaggccgagagccgcgaggtgtacgcgggcaaagtggtgcccaaatcgctgctggcc
aagccgcaccagaaggagaagatgtccatggagatcgccatccaccgcagcctggcgcac
cgccacgtcgtcggcttccagagcttcttcgaggacggcgatttcgtctacgtggtgctg
gagctgtgccgccgccggtcgctgctggagctgcacaagcggcggaaggcgctgagcgag
cccgaggtgcgctactacctgcggcagatcatcctgggctgccaatacctgcacagccag
cgcgtcatccaccgcgacctcaagctgggcaacctcttcctcagcgacgacatggaggtg
aagatcggtgactttggcctggccaccaaagtggagtatgatggcgagcccaagaagacc
ctgtgtgggacccccaactacatcgccccggaggtgctgggcaagaaggggcacagcttt
gaggtggatatatggtccattggctgcatcatgtatactctgctggtggggaaaccgcct
tttgaaacctcttgtctcaaagaaacatacatccgaatcaagaagaatgagtatactatt
cccaagcacatcaaccccgtagctgctaacctcattcagaagatgctgagatctgaccct
gccacgcgcccggctatcaacgagttgctgaacgatgagttcttcacatcagggtacatc
cccagccgcctgcccaccagctgtctcactgttgcacctcggttttcaatcgctcccagc
acacttgaactgaacgggcgaaagccactgacagcactcaacaaaggaccagaaagccct
gcattagaaaacttgcctgaaaaggaagatgcagctgggctgcgggaggtgggagacacc
attgagtgtcacttagcagacatgttacagcagctgactgcagtcaactcagccaaaccc
tctgagagaacagcagtgagacaagaagaagctgaagacccagcctgtattcccatcttc
tgggttagcaaatgggtggactattcggataagtatggtctaggttatcagctgtgtgac
aacagtgttggagttctcttcaatgactccactcgtcttatcatgtacaatgatggggac
agcttgcagtacattgagcaaaacaacaccgagtcctatttcactgtgagatcctgtccc
tctgccttgaacaagaagataacactattgaaatacttcaggaactacatgagtgagcac
ttgctgaaggcaggtgctaacatcacacctcgggaaggagacgagctggcacgtttaccc
tacctctgcacgtggttccggacccgcagtgccatcatcctgcacctcagcaatggcact
gtgcagatcaacttcttccaggaccacaccaaagtcatcttgtgccctctaatggctgct
gtcacatacatagatgagaaacgggacttccgcacgtacaagctgagcctcattgaggag
cacggatgctgcaaggagctggccagccgactacgctatgctcgcaccatggtggagaag
ctcctcagttcgaaatctggctcagcccgtgtgaaatcctccacttag

DBGET integrated database retrieval system