KEGG   Gallus gallus (chicken): 416581
Entry
416581            CDS       T01006                                 

Gene name
HS3ST2
Definition
(RefSeq) heparan sulfate glucosamine 3-O-sulfotransferase 2
  KO
K07808  [heparan sulfate]-glucosamine 3-sulfotransferase 2 [EC:2.8.2.29]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    416581 (HS3ST2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    416581 (HS3ST2)
Enzymes [BR:gga01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.29  [heparan sulfate]-glucosamine 3-sulfotransferase 2
     416581 (HS3ST2)
Glycosyltransferases [BR:gga01003]
 Unclassified
  Sulfotransferases
   416581 (HS3ST2)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 Sulfotransfer_2
Other DBs
NCBI-GeneID: 416581
NCBI-ProteinID: XP_015149990
CGNC: 16850
Ensembl: ENSGALG00000040675
Position
14
AA seq 363 aa
MAHRAPSGRAVAPSRRLARRVLFLFTLSLSCSYLCYSLLCCCGGPAAPRARCAPARSAAA
AKKLLQKSRACGRPPAEPPGSAAPARRPREPPAPPAGSAPGPARPGSKRLPQAIVVGVKK
GGTRAVLEFIRVHPDVRALGTEPHFFDRNYDRGLEWYRSLMPRTLDSQITVEKTPSYFVT
KEAPRRIFNMSRDTKLIVVVRNPVTRAISDYTQTLSKKPDIPTFEGLSFRNRSLGLVDTS
WNAIRIGMYAVHLQSWLQYFPLSQIHFVSGEKLITDPAGEMGKVQDFLGIRRVITDKHFY
FNKTKGFPCLKKTESNSSRRCLGKSKGRTHVQIDPEVIEQLRDFYRPYNIKFYETVGQDF
RWE
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcgcatagggcgccgagcgggcgggccgtggctccatcccggcggctggcgcggagg
gtgctcttcctcttcacgctgtcgctgtcctgctcctacctctgctacagcctcctctgc
tgctgcggcggccccgccgcgccccgcgcccgctgcgcgcccgcccgcagcgccgccgcc
gccaagaaacttctgcagaagtcgcgggcgtgcgggcggcctcccgcagagcctccgggc
agcgccgcgcccgcccgccgccctcgggagccccccgccccgcccgccggcagcgccccg
ggcccggcccgtccgggcagcaagcggctgccgcaggccatcgtggtgggcgtcaagaag
ggcggcacccgcgccgtgctggagttcatccgcgtgcaccccgacgtgcgcgccctgggc
accgagccccacttcttcgaccgcaactacgaccgcgggctggagtggtacaggagcctg
atgccacgcacactcgacagccagatcacggtggagaagacccccagctactttgtcacc
aaggaggccccacggcggatcttcaacatgtcgcgggacaccaagctgatcgtggtggtg
cgcaaccccgtcacccgcgccatctcggactacacgcagacgctctccaagaagcccgac
atccccaccttcgaggggctgtccttccgcaaccgcagcctgggcctggtggacacctcc
tggaacgccatccgtatcgggatgtatgccgtgcacctgcagagctggctgcagtacttc
cccctctctcagatccactttgtcagcggggagaagctgatcactgacccggctggggag
atgggcaaagtgcaggacttcctgggcatccggcgggtcatcaccgacaagcacttctac
ttcaacaagacaaaaggctttccttgcctgaaaaaaacagagagcaacagctcacggcgc
tgcctgggcaaatccaaggggaggactcacgtgcagatagaccccgaggtgatagagcag
cttcgggacttttacagaccttacaacatcaagttctacgaaacggtcgggcaggacttc
aggtgggaatga

DBGET integrated database retrieval system