KEGG   Gallus gallus (chicken): 416693
Entry
416693            CDS       T01006                                 

Gene name
NET1
Definition
(RefSeq) neuroepithelial cell-transforming gene 1 protein
  KO
K20683  Rho guanine nucleotide exchange factor 3/8
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    416693 (NET1)
Membrane trafficking [BR:gga04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    416693 (NET1)
SSDB
Motif
Pfam: RhoGEF PH_13 PH_5 PH IQ_SEC7_PH
Other DBs
NCBI-GeneID: 416693
NCBI-ProteinID: NP_001025819
CGNC: 6397
Ensembl: ENSGALG00000008437
UniProt: Q5ZJM0
Position
1
AA seq 540 aa
MVAHDELGGLLPIKRTIRVIDSQNQSFREQEEPSNKRVRPLARVTSLANLISPVRNGAVR
RFGQTIQSFALRSDSKSPSCAQKSCSRSAAPTPPKRRNSVLWSEMLDVNMKESLSTKEIK
RQEAIYEMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDSYIPLHEDLLA
SLGEATKPDGTVEQIGPILVKWLPRLHAYKGYCSNQLAAKALLDQKKQDRRVQDFLQRCL
ESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHPDIQILEEAISIIQGVLSDIN
LKKGESECQYYIDKLEYLDEKQKDPRIEGSKALLCHGELKNKNGHKLYVFLFQDILVLTR
PVTRNERQSYQVYRQPIPVQELLLEDLQDGDVKMGGSFRGAFGNSDKAKNIFRVRFQDPS
PGQSHTLQANDIFHKQQWVNCIRTAIAPFQRTAAAAELKELPELSEESEENNPSVPNVRA
QRRQSAMSGITEMELDESTAECSSILDSEEAKGTKTHRTLSGHRKTREKQLSSKRKETLV
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggttgctcacgatgagctcgggggattgctccctatcaaaaggactatccgggtgatc
gactcacagaaccagtccttcagggagcaggaggagccaagcaataaacgggttcggcct
ttagcacgggtcacatccttggccaacttgatctctcctgtaagaaatggtgcagttcgg
cgctttgggcaaacaatacagtcatttgcccttcgcagtgacagcaaatctcccagctgt
gcccagaagtcatgtagcagatctgctgcccctacccctcctaaaagaagaaacagcgtc
ctttggtctgagatgttagatgtcaacatgaaagaatctctgagcaccaaagaaatcaaa
cgccaggaggcaatatatgagatgtccagaggagagcaggacctgattgaagacctgaag
cttgccaggaaggcttatcatgatcctatgctgaaactctctatcatgtctgaggaggaa
ctcacccacatatttggggacttggattcttacatccctctgcatgaagatttgttggca
agtttaggagaagcaacaaaaccagatggaacggtggagcagatcgggcccatccttgta
aagtggttaccacgactccatgcctacaaaggttactgcagcaatcagctggcagccaaa
gcactgctggatcagaagaaacaggaccgaagggtgcaggacttcctgcagcgctgcctc
gagtctcctttcagccgcaagttggacctctggagcttcttggacatccctcgaagtcgg
ctggtcaaatacccactgctcctaaaggagatcctgaggcacactcccaaagaccatcct
gatattcagattctggaagaagccatatctataatccaaggagttctctctgacatcaac
ttaaagaagggagagtcggagtgccaatattacatcgacaaactggagtatctggatgag
aagcagaaagacccaaggattgagggaagcaaagctttactgtgccatggggagctgaag
aacaaaaatgggcataaactctacgtcttcctcttccaagacatcctggttctgacccgg
ccggtcactcgcaacgagcgtcagtcctaccaagtgtacaggcagcccatccctgtgcag
gaactgctcctggaagacctgcaggatggagatgtgaaaatgggaggctccttccgagga
gcgttcggcaattcagataaagctaaaaatatcttccgagttcgtttccaagacccctcc
ccaggccagtcccacacgctgcaggccaacgatatcttccacaagcagcagtgggtgaac
tgcatccgtaccgccattgctcccttccagcggaccgctgctgccgcagagctgaaggag
ctgccggagctcagcgaggagtcagaagagaacaacccctccgtgcccaacgtcagagcc
cagaggaggcagtctgccatgtcgggcatcactgagatggagctcgatgagagcacagcc
gagtgcagctccatcctggactcagaggaagccaagggcacgaaaacacacagaacactc
tctgggcacaggaaaacgagggagaagcagctcagcagcaagcggaaagaaacactggtg
tag

DBGET integrated database retrieval system