KEGG   Gallus gallus (chicken): 416746
Entry
416746            CDS       T01006                                 

Gene name
CDC42BPA
Definition
(RefSeq) serine/threonine-protein kinase MRCK alpha
  KO
K16307  serine/threonine-protein kinase MRCK [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    416746 (CDC42BPA)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     416746 (CDC42BPA)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   416746 (CDC42BPA)
SSDB
Motif
Pfam: CNH Pkinase KELK PK_Tyr_Ser-Thr DMPK_coil C1_1 Kinase-like Pkinase_C PBD Seadorna_VP7
Other DBs
NCBI-GeneID: 416746
NCBI-ProteinID: NP_001186372
CGNC: 6969
Ensembl: ENSGALG00000009158
UniProt: E1BWT5
Position
3
AA seq 1718 aa
MSGEVRLKQLEQFILDGPTQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWA
KPFTSKVKQMRLHKEDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETA
CFREERDVLVNGDNQWITTLHYAFQDENYLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF
YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGT
PDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPAQVTDVSESAKDLIRRLICSREHRLGQNGIEDFKNHPFFAGIDWDNIRNCDAPYIP
EVSSPTDTSNFDVDDDCLKNSETMPPPSHTAFSGHHLPFVGFTYTSSCVLSDRSCLRLTA
GPPSMDLDANIQRTLEDSLATEAYERRIRRLEQEKLELSRKLQESTQTVQALQYSTVDGP
IAASKDLEIKSLKEEIEKLKKQVTDSGHLEQQLEEASTARRELDDASRQIKAFEKQVRTL
KQEREDLNKELAESSDRLKSQAKELKDAHSQRKLAMQEFSEMNERLTDLHSQKQKLARQL
RDKEEEMEVVMQKVESLRQELRRTERLKKELEVQAEAAAAEASKDRKLRERSEQYSKQLE
SEVEGLKQKQIGRSPGVSSIEHQQEITKLKADLEKKSVFYEEELSKREIMHANEIKSLKK
ELRDAESQQLALKKEIMILKDKLEKTRRENQSEREEFETEFKQKYEREKILLTEENKKLS
NELDKLTTMFERLSMNNRQLEEEMRDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQA
LASKMTEELEALRNSSLGARATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQDEL
NKVKASCISTECKLQESEKKNLELLTDIERLKKETEELRSEKGVKHQDSQNSFLAFLNAP
TSALDQFEVTDHPPRSIHTPTMRTAYIGSGLSAPKPKAHQFVVKSFNTPTKCNQCTSLMV
GLIRQGCTCEVCGFSCHVTCADKAPAVCPIPPEQTKGPLGIDPQKGIGTAYEGHVRVPKP
AGVKKGWQRALAVICDFKLFLYDIAEGKASQPSVVVSQVIDMRDEEFSVSSVLASDVIHA
NRKDIPCIFRVTASQLSATSNKCSILILTDGENEKSKWVGVLNELHRILKKNKLKDRSVY
VPKEAYDSTLPLIKTTQSAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKVHQIELI
PSEQLIAVISGRNRHVRLFPMTALDGRETEFYKLAETKGCQSIVSGHVRHGALTCLCVAM
KRQVLCYELNQSKTRHKKIKEIQVQGNVQWMSVFSERLCVGYQSGFLKHPLHGEGSPYSL
LHPDDHTLSFISQQPTDAICAVEISNKEYLLCFSSVGVYVDCQGRRSRQQELMWPATPSS
CCYNAPYLSVYSENAIDIFDVNSMEWIQTIPLKKVRPLNTEGSLNLLGLETVRLIYFKNK
MAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISNP
TNFNHIAHMGPGDGIQILKDLPMNLRPQESRTVFSGSVSIPSITKSRTEPGRSMSASSGL
AARSSAQNGSALRREFSGGSYGAKRQPMASPSDGSLSSGGLDQGSDAPTRDYEREDSDSP
RHSTASNSSNLSSPPSPVSPHKTKSLSLESSDHVSWDS
NT seq 5157 nt   +upstreamnt  +downstreamnt
atgtctggagaagtgcgtctgaagcagttggagcagtttattttggatgggccaactcag
actaatgggcagtgcttcagcgtggaaaccttgctggatatactcatctgcctgtacgac
gaatgtaacaattcccctctgagaagagagaagaacatcctcgagtatctagaatgggcc
aaaccatttacatctaaagtgaaacagatgcgactacataaagaagattttgaaatcctg
aaggtgattggtcggggagcttttggtgaggttgcagtagtaaaactgaagaatgcagat
aaggtttttgccatgaagatacttaataagtgggagatgctgaagagagctgaaacagca
tgttttcgagaagagagagatgtgttagtgaatggagataaccagtggatcacaacatta
cattacgcgttccaggatgaaaactatttatacctggttatggattattacgttggagga
gacctactgacgttgcttagcaagtttgaggacagattacctgaagatatggctcgattt
tatttggctgaaatggtgatagccatcgattctgtgcatcagttgcattatgtccacagg
gatattaaaccagacaacatcttgatggatatgaatggccatattcgattagcagatttt
ggttcttgtctgaaactgatggaagatggaacggttcaatcttcagtagctgttgggacg
ccagactacatctctccagaaattttgcaggccatggaagatggaaaagggaagtatggg
cctgagtgtgactggtggtccctaggcgtttgcatgtatgaaatgctttatggagaaaca
cccttttatgctgagtccttggtggagacctatgggaaaataatgaaccacaaagagagg
ttccagtttcctgctcaagtgacggatgtctctgaaagtgcaaaggacctcatccgaagg
ctaatttgtagcagagagcatcggcttggacagaatgggatagaagactttaagaaccat
ccattttttgctgggattgactgggacaacattagaaactgtgatgcaccttacattcca
gaagtcagcagccccactgatacatcaaacttcgatgtggatgatgattgcttaaaaaat
tctgagacgatgcctccaccatcacacactgcgttttctggtcatcatttaccatttgta
ggtttcacatatacaagtagctgtgtgctttcagaccgcagctgtctaagactgacagct
ggaccaccctccatggatcttgatgccaacattcaaagaactttggaggacagtttagca
acagaagcttatgagaggagaataagacgtctagagcaggaaaagcttgaacttagtaga
aaactgcaagagtccactcagacagtccaggctcttcagtattcaacagtggatggccca
attgcagcaagcaaagatttagaaattaaaagcttaaaagaagaaattgaaaagttgaag
aaacaggtaacagattctggacatctagaacagcaacttgaagaggccagcactgcaagg
cgggagttggacgatgcttccagacaaataaaggcttttgagaaacaggttagaacactg
aagcaagagagggaagatcttaataaggaactggcagagtctagtgacagattaaaatct
caagccaaagagctgaaagatgcacacagccagcggaaattggcaatgcaggagttctca
gagatgaacgagcggctgacagacttgcactctcaaaaacaaaagcttgcccgccagctc
cgagataaggaagaagaaatggaagtggtgatgcaaaaagtagaaagtttaaggcaagag
ttacgcagaacagagagacttaaaaaagaactggaagtccaagctgaagctgcggctgct
gaggcatccaaagacaggaaattgcgagagcggagtgagcagtactctaagcagctggaa
agtgaagtagaggggctaaagcaaaaacagattggtcgctcacctggggtaagcagtata
gaacaccagcaagagatcactaaattaaaggcagacctggaaaagaaaagtgttttctat
gaagaggaactatctaaacgtgaaataatgcatgctaatgaaataaaaagtctgaagaag
gaactacgggatgcagagagccagcagcttgcacttaagaaggagatcatgattttgaaa
gacaagttagagaaaaccagaagagaaaaccaaagtgaaagagaggaatttgaaacagag
ttcaaacagaagtatgaacgggaaaagattctgctaacagaggaaaacaagaaactttca
aatgaacttgataagctcaccaccatgtttgagaggctgagtatgaataaccggcagctg
gaagaagaaatgagagacctagctgataaaaaggaatctgtagcccactgggaggcccaa
attaccgagatcatccaatgggtaagtgatgaaaaagatgctcgaggttatcttcaagcc
ttggcttctaaaatgacagaagaactagaggccctgaggaattccagcttgggtgcaaga
gctacagacatgccctggaagatgcgccgttttgcaaagctagatatgtccgcaaggttg
gaactacagtcagctcttgatgctgaaatcagagccaaacaggctattcaagatgagttg
aataaagtcaaagcttcctgtatctctacagagtgtaaattgcaagaatcagagaagaag
aatttggaactgttgacagatattgaaaggctgaagaaggagacagaagaacttagatca
gaaaagggtgtaaagcaccaagactcacagaattctttcttggcatttttgaatgcgcct
acctctgctctggatcaatttgaagttacggatcatcctcctcgatcaattcacacacca
accatgcggactgcgtatattggatcgggactctctgcaccaaagcctaaagcccatcag
tttgtagtgaaatcatttaataccccaacaaaatgcaatcaatgcacatctctaatggtt
ggtttaataagacagggctgcacttgtgaagtgtgtggattctcctgccacgtgacctgt
gcagacaaggcccccgcagtatgtccaatccctcctgaacagactaagggccctttggga
atagatcctcagaaaggtataggaacagcttacgaaggacatgtccgagtaccaaaacca
gctggtgtaaagaaaggttggcagagagcactggcggtaatctgtgattttaaactcttc
ctgtatgatatagcagaaggaaaagcatcgcagccaagtgtggtagtgagtcaggtcata
gacatgagggatgaagaattctcagtgagttctgtcttggcttcggatgtcatccatgca
aatcgaaaagatatcccctgtatctttagagtcacagcttcccaactctctgcaaccagt
aataagtgttcaatcctgattctaacagacggtgagaatgaaaaaagcaagtgggtagga
gtgctgaatgaattgcataggatcttgaagaaaaacaaactcaaagaccgctcagtctat
gttcccaaagaagcttatgacagcaccttacccctcatcaaaacaacgcagtcagcagca
atcatagatcatgaaagaatagcactggggaatgaagaagggttatttgttgtgcatgtc
accaaagatgagataatccgtgttggtgataataagaaggttcatcagattgagcttatc
ccaagcgaacagctcattgcagtaatctcaggacgaaaccgtcacgtgcgacttttccct
atgacagccctggatggaagggagactgagttttataagttggcagaaacaaaaggctgc
cagtcgatagtttctggacacgtgcgccatggagcccttacatgcctttgtgtagctatg
aaaaggcaagtcctctgttatgaactaaatcagagtaagacacgtcacaaaaagatcaag
gagatccaagtccaggggaacgtccagtggatgtcggtcttcagtgagcgtctttgtgtg
ggctaccagtcaggtttcttaaagcatccccttcatggagaaggcagcccatacagtctg
ctccatccagatgaccacacgctatcgtttatctcacagcagccaactgatgccatctgt
gcagtcgaaatctcaaataaagaatacctgctgtgttttagcagcgtaggggtttacgtt
gactgccagggccggagatcaagacaacaagaattgatgtggcctgcaactccatcatct
tgctgttacaatgcaccatacctctctgtgtatagcgaaaatgcaattgatatctttgac
gtgaactccatggagtggattcagactattcctctcaaaaaggtacgacccttgaataca
gaaggatcactcaaccttttaggtttggagacagttagattaatatatttcaaaaacaaa
atggcagagggtgatgaactggtggttcctgaaacatcagataacagccggaagcaaatg
gttcgaaacatcaacaacaagcgccgctattcattcagagtaccagaagaggagaggatg
cagcagaggagggagatgctacgcgatccagaaatgagaaataaattaatttctaaccca
actaattttaaccacatagcacatatgggtcctggagatggtatacagattctcaaagac
cttccaatgaatcttcggcctcaggaaagtcggaccgtattcagtggctctgtcagtatc
ccatcgatcacgaaatcccgcacagaaccaggacgatcgatgagcgcaagcagtgggtta
gcagcaagatcatctgcacaaaatggcagtgcattgcggagggaattctcaggaggtagc
tatggagcaaagcgtcagcctatggcatcgccctcagatggttcgttatcctctggtggc
ctggaccaaggcagtgatgcaccaacaagggactatgagcgagaggactccgactcaccg
agacactccactgcatcgaacagctccaacctcagcagccctcccagccctgtttctcct
cacaagaccaagagcctctcgctggagagctctgaccacgtgagttgggactcatga

DBGET integrated database retrieval system