KEGG   Gallus gallus (chicken): 416749
Entry
416749            CDS       T01006                                 

Gene name
CCNF
Definition
(RefSeq) cyclin-F
  KO
K10289  F-box protein 1 (cyclin F)
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    416749 (CCNF)
   03036 Chromosome and associated proteins [BR:gga03036]
    416749 (CCNF)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     416749 (CCNF)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    416749 (CCNF)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF4677
Other DBs
NCBI-GeneID: 416749
NCBI-ProteinID: XP_415043
CGNC: 6992
Ensembl: ENSGALG00000038502
Position
14
AA seq 782 aa
MKAGAVRCRCSRCFCFPSKRRLRERPRVLPLLSVPEDAVLHVVKGLPAEDLLSLRAVRSP
LKYLVDDLAGVWACASFEDVWPSAKTLKVFERAAERGNFEAAVKLGIAYLYNEGLSISDE
GRAEVNGLKASHFFSLAERLNVCAAPFIWLFIRPPWSLTGSCCKAVVYESLKAECQLDKA
QKGSILYCLAKVLSLFEDEEKRKESLEMFEESSKQGCLNSSYLLWENNRKVAMLDPGRYL
QSLRKLRDYAAKGCWDAQIALAKACGNGNQLGLEAKSSSEMVAQMFQASRPISKQNIFTV
QKKINETMRYILVDWLVEVATMKDFSCLCLHMTVGCVDRYLKLRPVPRYQLQLLGIACMV
ICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIISALEGKIRIPTVVDYKEVLSNIV
SLERRTLHLYSFICELSLLNTSLFVYSPARLAAAALLLAKILHGHAHPWTSQLSECTGFS
LEDLLPCVLHLHQKCFHDEVPKDYRQVSLTAVRQRFEDERYDEVGKEKVMSYSQLCSLLG
VKQEDPKPSPLHTNVIEIKAFFSSPSGKRSKRRREDSTQDDRGSLVTTPTAELSTQEESL
LDSFLDWSLDSCSGYEGDRESEGERDGDVTSPSGVLDVTVVYMDPAEHCCQDSSDEDSLS
VEWPGHAAPPRKARTPDETCRVSACTASRNPNWEGSSGYSSINGASPTSSVEGSCGVPLK
PTSALSCGSTMNKEQCLPHYLESCLQSVRARASDRNSNRRQVKRKNLAEHSEERVNLGFL
SL
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgaaggcgggcgcggttcgctgccgctgttccagatgcttctgtttcccttccaagcga
aggctaagggaacggccccgcgtcctgccgttgctaagtgtgcccgaggatgctgtgctt
catgttgtgaaaggccttcctgctgaggacctcctctcactcagagcggtgcgctcccct
cttaaatacctcgtggatgatctcgctggtgtttgggcatgtgcaagttttgaagacgta
tggccttctgcgaaaactctgaaggtgtttgaaagagctgctgaaaggggcaactttgaa
gctgctgtgaagctgggaatagcgtacctgtacaatgaaggcttgtccatctccgatgag
ggccgtgcagaagtgaatggattaaaggcatctcatttcttcagtcttgcagagcggctg
aatgtgtgtgcagccccattcatctggctttttattcgtcctccctggtccttgactgga
agctgttgtaaagctgtggtctatgagagtcttaaagcagagtgtcagctggacaaagct
cagaaaggatctattctgtactgcttggctaaggtcttgagtctctttgaggatgaagaa
aaaagaaaagagtcccttgaaatgtttgaagagtcttcaaagcagggttgtttaaatagt
tcctacctcctttgggaaaataacagaaaggttgctatgttagaccctggcagatacctc
caaagtctcaggaagctacgggactatgcagcaaagggatgctgggatgcacagatagct
ttagccaaagcttgtggaaatggaaaccaactaggattagaagcaaaatcttccagtgaa
atggtggctcagatgtttcaagcctcccgtcctatcagcaagcaaaatatcttcactgtg
caaaagaaaataaatgaaacaatgaggtacatcctggttgactggctggtggaagtggct
accatgaaagacttttcttgcctatgccttcacatgacagtggggtgtgtggaccgttac
ttgaagctgagacctgtaccccggtatcaactccaactcctgggaatagcctgcatggtc
atttgcacacgttttatcagcaaagaaatcttgacaatacgggaggctgtatggctaacg
gacaatacatacaaatatgaagacctggtcagaatgatgggcgagatcatctctgcccta
gagggaaagataaggatacctactgttgtggactacaaagaagtactgtcaaacatagtc
tcactggagagaagaactcttcacctttacagcttcatttgtgagctgtcgctcttaaac
acaagcctttttgtgtactctccagctcggctggctgctgcagcactgctgctggctaag
atactgcatggccacgcacatccctggaccagccagctgtctgagtgcactgggttctct
ctcgaagacctgttgccatgtgtgttacaccttcatcaaaaatgtttccatgatgaggtc
cctaaggattataggcaggtgtctttaactgcagtgagacaaagatttgaagatgagcgt
tacgatgaagtaggcaaagaaaaggtgatgagctacagccagctctgttcactgctgggt
gtgaagcaggaggacccaaagcccagtcccttgcacacaaatgtcatagaaattaaagct
ttctttagctctccctctggaaagagatctaagaggaggagggaagacagcactcaggat
gacaggggcagcttagtgactacacctacagctgagctatccacccaggaagaaagtctt
ctggacagctttctggactggagtttagattcctgctctggttatgaaggtgatcgggaa
agtgaaggcgagagggatggagatgtcacaagtcccagtggagtcttggatgtgactgtg
gtttacatggatccagcagagcactgctgtcaggactccagtgatgaagacagcttatct
gtagagtggcctgggcacgcagcaccaccgaggaaggccaggacaccagatgaaacttgc
agagtttcagcctgcactgcctcaagaaatcccaactgggaagggagctcgggctactcc
tccatcaatggtgcaagtcctacatcttctgtggaaggcagctgtggagtacctctcaaa
cctacctcagcactgtcttgtggcagtaccatgaacaaggagcagtgccttcctcactac
ctggaatcatgtttacagtcggtgcgggctagagctagtgataggaattccaaccgaagg
caagtcaagcgcaaaaacttagcagaacatagtgaagaaagggtgaacttgggcttctta
agcctctga

DBGET integrated database retrieval system