KEGG   Gallus gallus (chicken): 416754Help
Entry
416754            CDS       T01006                                 

Gene name
AMDHD2
Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00520  Amino sugar and nucleotide sugar metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    416754 (AMDHD2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     416754 (AMDHD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 416754
NCBI-ProteinID: NP_001332924
CGNC: 7016
Ensembl: ENSGALG00000009234
UniProt: F1P5J8
Position
14
AA seq 409 aa AA seqDB search
MPSNKSVSDAPIAQFTNCRLLRGRRLQREDLWVREGKILNPEKLFFDEKGSADVQLDCKG
CILAPGFIDVQINGGFGVDFSLATDDFRSGIDLVGRKILSHGVTSFCPTLVTSPPSVYHQ
ILPQIDVRNGGAHGAGVLGAHMEGPFISKEKKGAHPEHCIRTFEENAFQDLLATYGSLDC
VRIVTLAPEIKRSSEVIRELTKRGICVSLGHSVANLSQAEEAVQHGATFITHLFNAMLPF
HHRDPGIVGLLTSDKIPAGRRVFYGMISDGIHTNPAALRIAHRAHPKGMVLVTDAIAGMG
LAPGRHTLGQQVVEIDGLNTYIAGTKTLSGSVATMDTCVRHFLEATGCSVETALEAASLH
PAQLLGIEDRKGTLNYDSDADFLMLDDSLHVQATYIAGEEVWRRDALGM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaacaaatccgtgtcggacgctcccatcgcgcagttcaccaactgccgcctc
ctgcggggccgccgcctgcagcgggaggacctgtgggtgcgggaggggaagatcctcaac
cccgagaagctcttcttcgacgagaagggctctgccgacgtccagctggactgcaagggc
tgcatcctcgccccgggcttcatcgacgtgcagatcaacggaggctttggggtggatttc
tccctggctacggatgacttcagatcagggattgacctggtcggccggaaaatactctcc
catggagtgacctccttctgtcccaccctggtcacatcccctccatccgtgtaccaccag
attcttccccagatcgatgtaagaaatggtggagctcacggagctggtgtcttgggcgct
cacatggaagggccattcatcagcaaggagaaaaagggggcacatccagagcactgcatc
cgcaccttcgaggaaaatgcattccaggacttgcttgccacctacgggtccctggactgc
gtccggattgtcaccctggccccagagatcaagaggagcagtgaggtgatccgggaactc
accaagcgaggcatctgtgtctcgctcggtcactcagtggctaatctctcccaggccgag
gaggctgtgcagcacggtgctaccttcatcactcacctcttcaatgccatgttgccgttc
caccatcgtgaccccgggatcgtggggctgctgacaagtgataagattcctgctgggcgg
agggtcttctacggcatgatctctgatggcatccacaccaaccctgctgccctgcgaatc
gcccatcgagcccaccccaaaggcatggtgctggtgacggatgctattgctggcatgggg
ctggcaccaggtcggcatacactgggccagcaggtggtggagatcgatgggctgaacacc
tacattgcaggcacaaagaccctgagtggtagtgtggcaaccatggacacgtgtgtgcga
cacttcctggaagccacagggtgctcagtagagaccgcactggaggcagcatcattgcat
cctgcccagctcttggggattgaagacagaaaggggactctgaattatgattctgatgca
gatttcctgatgctggatgatagcctgcacgtgcaagccacgtacatcgcgggcgaggaa
gtctggagacgggatgccttaggcatgtga

DBGET integrated database retrieval system