KEGG   Gallus gallus (chicken): 416826
Entry
416826            CDS       T01006                                 

Gene name
CDK2AP1
Definition
(RefSeq) cyclin-dependent kinase 2-associated protein 1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: CDK2AP DUF4248
Other DBs
NCBI-GeneID: 416826
NCBI-ProteinID: NP_001034353
CGNC: 2485
Ensembl: ENSGALG00000034919
UniProt: A0A1D5PQL4
Position
15
AA seq 122 aa
MSLGMSYKPNLNAHIPGTPLAPAGSVHSPSTSMATSAQYRQLINDYGPPSLGYTQGIQGT
SSSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNA
RS
NT seq 369 nt   +upstreamnt  +downstreamnt
atgtcgctgggaatgtcttacaaacccaacttgaacgcccacatccccgggactcccctc
gccccggctgggagcgttcactctccctccacaagtatggcaacgtctgcacaatacaga
cagcttataaatgactatgggcccccatcgctagggtacacacaagggatacagggtacc
agcagcagtcaagtaccgcaaagcaaatatgcagaacttctagctatcattgaagaatta
ggaaaagagatcaggcccacatatgctgggagtaaaagtgcgatggagaggctaaaacga
ggcattattcatgccagaggattagttcgggaatgcttggctgagaccgaacgaaatgca
agatcctag

DBGET integrated database retrieval system