KEGG   Gallus gallus (chicken): 416845
Entry
416845            CDS       T01006                                 

Symbol
ORAI1
Name
(RefSeq) calcium release-activated calcium channel protein 1
  KO
K16056  calcium release-activated calcium channel protein 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    416845 (ORAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    416845 (ORAI1)
Ion channels [BR:gga04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   416845 (ORAI1)
SSDB
Motif
Pfam: Orai-1 DUF1772
Other DBs
NCBI-GeneID: 416845
NCBI-ProteinID: NP_001025829
CGNC: 3116
Ensembl: ENSGALG00000004240
UniProt: Q5ZL05
Position
15
AA seq 226 aa
MSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDAEHDYPRGLLIAF
SACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIG
TLLFLAEVVLLCWVKFLPLKKNPLDPAENSNSSITSGQAAAIASTSIMVPFGLIFIVFAV
HFYRSLVSHKTDRQFQELNELAEFAWLQDQLDHRGDAISPAVTHFA
NT seq 681 nt   +upstreamnt  +downstreamnt
atgagcctgaacgagcactcgatgcaggcgctgtcctggcggaagctctacctgagccgc
gccaagctgaaggcttccagccgtacctccgcgctgctctccggcttcgccatggtggcc
atggtagaagttcagcttgatgcagaacatgactacccacgaggtctcttgatagccttc
agtgcctgtactacagtccttgttgctgttcacctttttgcactcatgataagtacctgc
attcttccaaatatagaggctgttagcaacgtgcataatctcaactctgtaaaggaatct
cctcatgagcgtatgcatcggcacattgagcttgcctgggcattttctactgtcattggg
actttgctctttcttgcagaggtggtgttgctgtgttgggtgaagtttcttcccctgaag
aagaacccccttgacccagctgagaacagcaattctagcatcacatcaggacaggcagca
gccattgcatcgacatctatcatggttccctttggactgattttcattgtctttgcagtc
cacttctacaggtctctggtgagccataaaacagacaggcagtttcaagaactgaatgaa
cttgctgaatttgcatggctccaggatcagctggatcacagaggtgatgccatctcccca
gctgttacccattttgcataa

DBGET integrated database retrieval system